GapMind for catabolism of small carbon sources

 

Aligments for a candidate for frcA in Pseudomonas fluorescens FW300-N2E2

Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate Pf6N2E2_1456 D-xylose transport ATP-binding protein XylG

Query= uniprot:A0A0C4Y5F6
         (540 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1456 D-xylose transport
           ATP-binding protein XylG
          Length = 518

 Score =  326 bits (835), Expect = 2e-93
 Identities = 206/510 (40%), Positives = 304/510 (59%), Gaps = 20/510 (3%)

Query: 13  LLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTADP-GGEC 71
           LL +  I KTF GV+AL  +++    GE   L GENGAGKSTLMK+LS  Y      GE 
Sbjct: 5   LLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPYGTWDGEI 64

Query: 72  HIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRG-LVARGDMVRA 130
             DGQ ++          G+ +I+QEL+L P+LSVAENI++G  L   G  +    M+  
Sbjct: 65  LWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGRMNYPAMIHR 124

Query: 131 CAPTLARLGA-DFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTHETDRL 189
               +  L   D + +  V+      +QLVEIA+A++ +AR+L++DEP++ L+  E + L
Sbjct: 125 AEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEVL 184

Query: 190 FALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVKMMVGR 249
             +IR L+ +G+A +YISH++ E+  + D ++V+RDG  + T   A +S   ++  MVGR
Sbjct: 185 LDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMADMSIPKIITQMVGR 244

Query: 250 DLSGFY-TKTH--GQAVEREVMLSVRDVADGRR--VKGCSFDLRAGEVLGLAGLVGAGRT 304
           ++S  Y T+ H  G+ +      +  DV + RR  V   SF L+ GE+LG+AGLVGAGRT
Sbjct: 245 EMSNLYPTEPHDVGEVIFEARHFTCYDVDNPRRKRVDDISFVLKRGEILGIAGLVGAGRT 304

Query: 305 ELARLVFGA-DARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLD 363
           EL   +FGA   R  GEV +           +    P ++I AG+  + EDRK QG+  D
Sbjct: 305 ELVSALFGAYPGRYEGEVWLNGQQ-------IDTRTPLKSIRAGLCMVPEDRKRQGIIPD 357

Query: 364 QSVHENINLIVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKV 423
             V +NI L V    +  L R++  A      + I  + ++ A   + + +LSGGNQQK 
Sbjct: 358 LGVGQNITLAVLDNYSK-LTRIDAEAELGSIDKEISRMHLKTASPFLPITSLSGGNQQKA 416

Query: 424 MLSRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDR 483
           +L+++L  +PRVLILDEPTRGVD+GAK EIY+L+ ALA  GV+I+M+SSEL EV+G+ DR
Sbjct: 417 VLAKMLLTKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVSDR 476

Query: 484 VLVMREGTLAGEVRPAGSAAETQERIIALA 513
           VLV+ +G L G+     +   TQE+++A A
Sbjct: 477 VLVIGDGQLRGDFI---NHELTQEQVLAAA 503


Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 594
Number of extensions: 29
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 540
Length of database: 518
Length adjustment: 35
Effective length of query: 505
Effective length of database: 483
Effective search space:   243915
Effective search space used:   243915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory