Align Uncharacterized protein (characterized, see rationale)
to candidate Pf6N2E2_3381 Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE
Query= uniprot:E4PLR5 (279 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3381 Length = 274 Score = 397 bits (1019), Expect = e-115 Identities = 192/273 (70%), Positives = 226/273 (82%), Gaps = 2/273 (0%) Query: 1 MSQLFYDAAPNATRVSPEREADRHYP-EKPEAVTLFGTCVVDLFFPEAGLDTIRLLEREG 59 MS+LFY+A PNATRV+P R YP EKP+ V LFGTCVVDLF+PEAG+D I LLEREG Sbjct: 1 MSELFYNAVPNATRVAPPLPEPRQYPSEKPQRVYLFGTCVVDLFYPEAGMDAIHLLEREG 60 Query: 60 VRVHFPQEQSCCGQPAWTSGYRDEAKAVARAQLDILDRSGLPVVVPSGSCAGMFRHHYPA 119 +RV +PQ QSCCGQPA+TSGY ++A+ VARAQL + PVVVPSGSCAGM R HY Sbjct: 61 IRVDYPQGQSCCGQPAYTSGYTEQARTVARAQLALFAED-YPVVVPSGSCAGMLREHYAD 119 Query: 120 LFADEPDTLKRVEALAERTFELTEFLLKVCRVQLADRGAPSKIALHTSCSARREMNTHLH 179 LF DEPDTLK+V+ALA RT+EL EFLL VC+VQL D G P K+ALHTSCSARREMNTHLH Sbjct: 120 LFKDEPDTLKQVQALAARTYELAEFLLFVCKVQLNDSGEPVKVALHTSCSARREMNTHLH 179 Query: 180 ARELLQQLEGVERIDHDHESECCGFGGTFSVRMPEVSGAMVKDKTRSLIDSGAVEMVTAD 239 R LL QL VER++H HESECCGFGGTFSVRMP++SGAMV DKTR+L +SGA ++++AD Sbjct: 180 GRALLAQLRNVERVEHSHESECCGFGGTFSVRMPDISGAMVADKTRALKESGAHKVISAD 239 Query: 240 GGCLMNINGSLEKQKESFRGRHLASFLWERTNG 272 GCLMNING+LEKQ+E+ RG+HLASFLW+R+ G Sbjct: 240 CGCLMNINGALEKQQEALRGQHLASFLWQRSGG 272 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 274 Length adjustment: 25 Effective length of query: 254 Effective length of database: 249 Effective search space: 63246 Effective search space used: 63246 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory