Align gluconolactonase (EC 3.1.1.17) (characterized)
to candidate Pf6N2E2_488 Gluconolactonase (EC 3.1.1.17)
Query= BRENDA::Q15493 (299 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_488 Length = 301 Score = 136 bits (342), Expect = 7e-37 Identities = 91/303 (30%), Positives = 153/303 (50%), Gaps = 15/303 (4%) Query: 4 IKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVAL 63 ++ E ++ GESPVW N+L +V+IP+ + W++ + ++Q ++ +A Sbjct: 1 MQAELIVDARNAVGESPVWVPEENALYWVNIPSGGLQCWNASSGKLQGWEAPEMLACIAR 60 Query: 64 RQSGGYVATIGTKFCALNWKEQSAV---VLATVDNDKKNNRFNDGKVDPAGRYFAGTMAE 120 Q GG+VA + + F L+ + ++ + A V++ + + R NDG+ D GR++AG+M Sbjct: 61 HQDGGWVAGMESGFFRLHPNDDGSLDSELCANVEHSRTDMRLNDGRCDRQGRFWAGSMVL 120 Query: 121 ETAPAVLERHQGALYSLFPDHH--VKKYFDQVDISNGLDWSLDHKIFYYIDS--LSYSVD 176 +G +Y V+ + NGL +S D + Y DS L + Sbjct: 121 NMGA---NADEGRMYRYEAGQRSPVEAQLSGFIVPNGLGFSPDGRTMYLSDSHPLVQQIW 177 Query: 177 AFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQ 236 AFDYD+ +G SNRR + PDG +DA+G W+ + G + R P G+ + Sbjct: 178 AFDYDIDSGTPSNRRLFVDMMPLAGRPDGAAVDADGCYWICANDAGLIHRFTP-DGRLDR 236 Query: 237 TVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYS 296 ++++PV K T C FGG ++VT R G D + Q AGG+F + GVKG+A + Sbjct: 237 SLQVPVKKPTMCAFGGSRLDTLFVTSIRPGDDND---PQSLAGGVFALNP-GVKGLAEPA 292 Query: 297 YAG 299 + G Sbjct: 293 FGG 295 Lambda K H 0.319 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 301 Length adjustment: 27 Effective length of query: 272 Effective length of database: 274 Effective search space: 74528 Effective search space used: 74528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory