Align ABC transporter for D-Trehalose, permease component 1 (characterized)
to candidate Pf6N2E2_1647 Maltose/maltodextrin ABC transporter, permease protein MalF
Query= reanno::Smeli:SM_b20326 (328 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1647 Length = 321 Score = 379 bits (973), Expect = e-110 Identities = 183/301 (60%), Positives = 235/301 (78%), Gaps = 5/301 (1%) Query: 23 LQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSWIT 82 +Q +RVR+AWLFL+P L LALVA WPL+RT +FS T+ASL + A FVG +NYL + Sbjct: 22 VQRRRVRAAWLFLSPMLLCLALVAAWPLLRTFWFSLTDASLADTGDATFVGLSNYLFHSS 81 Query: 83 LKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAI 142 + G+L DP WWNAV NTL FTV+SV +E LGL+VAL+LN +F GR LVRA I Sbjct: 82 AG-----WSGILVDPQWWNAVRNTLHFTVVSVGLEIVLGLMVALLLNVKFTGRALVRALI 136 Query: 143 LIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWK 202 LIPWAIPTIVSAK+W+WMLNDQFGI+N +++GLGLI +AWTA D +M A +IVDVWK Sbjct: 137 LIPWAIPTIVSAKIWSWMLNDQFGIINHLMLGLGLIDAPLAWTADADLSMWAVIIVDVWK 196 Query: 203 TTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRVTLPLIRPALMVAVIFRMLDALR 262 T PF+ LL+LA LQM+P D YEAA++DG+HPV+VFW VTLPL+ PAL+VA IFR+LD+LR Sbjct: 197 TVPFVTLLMLAALQMLPSDCYEAARVDGIHPVKVFWWVTLPLLMPALLVAAIFRILDSLR 256 Query: 263 IFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGRLN 322 +FD+IYVLT N++ T +MSV AR++L +F YG+AAST+LFL++A I + Y++LGR Sbjct: 257 VFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLVVAVIAMAYLYLGRRQ 316 Query: 323 L 323 L Sbjct: 317 L 317 Lambda K H 0.328 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 321 Length adjustment: 28 Effective length of query: 300 Effective length of database: 293 Effective search space: 87900 Effective search space used: 87900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory