GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Pseudomonas fluorescens FW300-N2E2

Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate Pf6N2E2_1879 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)

Query= metacyc::MONOMER-20125
         (556 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1879
           Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
          Length = 511

 Score =  169 bits (429), Expect = 2e-46
 Identities = 146/528 (27%), Positives = 247/528 (46%), Gaps = 41/528 (7%)

Query: 22  RAATVYGDCTSVVYDAVSYTWSQTHRRCLCLASSIASLGIENGHVVSVLAPNVPQMYELH 81
           R+A  +G+  +++++   +++     +   LA+S+ S+G++   VVS+ +PN P+    +
Sbjct: 11  RSAARFGNKPAIIFEGKYWSFLDIDVQSSRLAASLESMGVKREDVVSIYSPNSPEWIITY 70

Query: 82  FAVPMAGAILNAVNLRLDARTISILLHHSESKLIFVDHLSRDLILEAIALFPKQAPVPRL 141
           +A+   GAI+N +N  L AR  +  + +  +  +F    + D +L   AL     P   +
Sbjct: 71  YAILKIGAIVNPLNTMLTAREAAFAIKNCGAVAVFS---TSDKLL---ALQEHIGPTEVI 124

Query: 142 VFMADESESGNSSELGKEFFCSYKDLIDRGDPDFKWVMPKSEWDPM-ILNYTSGTTSSPK 200
             ++ +      +  G   F     L+D      ++ +   + D +  + YTSGTT  PK
Sbjct: 125 SLISFDG----ITVAGMRHF---NLLVDANVAVREYPVTGIQKDDISTIGYTSGTTGQPK 177

Query: 201 GVVHCHRGIFIMTVDSLIDWGVPKQPVYLWTLPMFHANGWSYPWGMAAVGGTNICLRKFD 260
           G V  HR I      +          + +  LP+ H  G        A G T +  + FD
Sbjct: 178 GAVLSHRCILTNVSMTATMHLRTASDIAVSALPLSHVYGNVVMNSAIAYGMTLVLHKTFD 237

Query: 261 SEIIYDMIKRHGVTHMCGAPVVLNMLSNAP--GSEPLKTTVQIMTAGAPPPSAVLFRTE- 317
           +E I   I+ +G T + G P +   L N P  G+  + +  +    G   P   +   E 
Sbjct: 238 AEAILSSIQIYGATLLEGVPTMYIYLLNCPNLGAYDVSSLTRCTVGGQMMPYTAMENVER 297

Query: 318 SLGFAVSHGYGLTETAGLVVSCAWKKEWNHLPATERARLKSRQGVGTVMQTKIDVVDPVT 377
           +LG  +   +G+TE  GL  +        H    ER RL S       ++ +I       
Sbjct: 298 ALGCRLLELWGMTELGGLGTT--------HSLYGER-RLGSIGVALPHLEARI------- 341

Query: 378 GAAVKRDGSTL-----GEVVLRGGSVMLGYLKDPEGTAKSMTADGWFYTGDVGVMHPDGY 432
            A ++ DG  L     GE+ +RG  VM  YL  P+ TA++ T +GW  TGD+  M  +G+
Sbjct: 342 -AQLELDGDALPLGEIGELQIRGPVVMKHYLGRPDATAETKTDEGWLRTGDLARMDSEGF 400

Query: 433 LEIKDRSKDVIISGGENLSSVEVESILYSHPDILEAAVVARPDEFWGETPCAFVSLKKGL 492
           + I DR KD+ I+ G N+   E+E ++  HP +   AV +  DE  GE   A++  K G 
Sbjct: 401 IYIVDRLKDMFITAGFNIYPAELERVIAEHPSVAMVAVGSVLDEIKGELAKAYIVPKTGY 460

Query: 493 TKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKTSTGKVQKFILRDM 540
             +   ++I  +CR +L  Y VP+     E+LPKTS+GKV + +LR +
Sbjct: 461 --EIDIQQIERHCRDRLAAYKVPRLFQIVEDLPKTSSGKVMRRMLRQI 506


Lambda     K      H
   0.319    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 625
Number of extensions: 35
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 556
Length of database: 511
Length adjustment: 35
Effective length of query: 521
Effective length of database: 476
Effective search space:   247996
Effective search space used:   247996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory