Align Catechol 1,2-dioxygenase; EC 1.13.11.1 (characterized)
to candidate Pf6N2E2_997 Catechol 1,2-dioxygenase 1 (EC 1.13.11.1)
Query= SwissProt::P86029 (303 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_997 Length = 242 Score = 162 bits (409), Expect = 9e-45 Identities = 87/243 (35%), Positives = 138/243 (56%), Gaps = 7/243 (2%) Query: 41 LTTEDWLWGVDFINRIGQMSDSRRNEGILVCDIIGLETLVDALTNESEQSNHTSSAILGP 100 LT E+W G++F+ IG ++ +R E IL+ D +GL TLV A N + T + + GP Sbjct: 1 LTEEEWEKGIEFLTAIGHITTDKRQEFILLSDTLGLSTLVIA-QNHKKPEGCTEATVFGP 59 Query: 101 FYLPDSPVYPNGGSIVQKAIPTDVKCFVRGKVTDTEGKPLGGAQLEVWQCNSAGFYSQQA 160 F++ ++P Y G I +P V FV+G VT +G P+ A +EVWQ + AGFY Q Sbjct: 60 FHVANAPRYDLGEDI-SGGLP-GVPWFVKGTVTAKDGTPIPNATIEVWQADDAGFYDVQK 117 Query: 161 DHDGPEFNLRGTFITDDEGNYSFECLRPTSYPIPYDGPAGDLLKIMDRHPNRPSHIHWRV 220 G +++ R D G+Y F + P YPIP+DGP G +L+ ++RHP RP+H+H+ + Sbjct: 118 PDMG-DYHGRAVIQADANGHYYFRTIVPECYPIPHDGPVGKMLEALNRHPWRPAHLHFMI 176 Query: 221 SHPGYHTLITQIYDAECPYTNNDSVYAVKDDII---VHFEKVDNKDKDLVGKVEYKLDYD 277 + PGY L+T ++ Y ++D+V+ V+ +I V E + + + + Y LD+D Sbjct: 177 TAPGYQRLVTHVFREGGDYLDSDAVFGVRSSLIADWVRHESGIDPYGNSIDSLYYTLDFD 236 Query: 278 ISL 280 L Sbjct: 237 FIL 239 Lambda K H 0.316 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 242 Length adjustment: 25 Effective length of query: 278 Effective length of database: 217 Effective search space: 60326 Effective search space used: 60326 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory