Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate Pf6N2E2_4455 Glutamate transport ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4455 Length = 244 Score = 143 bits (360), Expect = 4e-39 Identities = 92/214 (42%), Positives = 128/214 (59%), Gaps = 8/214 (3%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLKK 69 L I+ S++EG VA+IG +GSGKSTLL+ LNGL G I + + A + DL+ Sbjct: 19 LKGIDLSVEEGQVVAIIGRSGSGKSTLLRTLNGLESINDGVIEVDGEYLDAARA--DLRS 76 Query: 70 LRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNFG-VKKEDAEQKAREMLQLVGLSEELLD 127 LR+KVG+VFQ + LF TV +++ P V K A AR+ML+ VGL E+ D Sbjct: 77 LRQKVGMVFQ--QFNLFPHLTVGENVMLAPQVVQKVPKAKAAVLARQMLERVGLGEKF-D 133 Query: 128 RSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTI 187 P LSGGQ +RVAIA LAM P+VL+ DE T+ LDP E++ + +L + G +T I Sbjct: 134 AFPDRLSGGQQQRVAIARALAMSPKVLLCDEITSALDPELVNEVLSVVRQLAKEG-MTLI 192 Query: 188 LVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 +VTH M A D+++ MH+G + G P+ LF Sbjct: 193 MVTHEMRFAREVGDKLVFMHQGKVHEVGDPKVLF 226 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 244 Length adjustment: 24 Effective length of query: 252 Effective length of database: 220 Effective search space: 55440 Effective search space used: 55440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory