Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate Pf6N2E2_1851 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
Query= BRENDA::Q0KAI3 (392 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1851 Length = 402 Score = 278 bits (711), Expect = 2e-79 Identities = 172/405 (42%), Positives = 237/405 (58%), Gaps = 16/405 (3%) Query: 1 MQQAVIV-DAIRSPMGRSKPGSAFTELHATELLAQVIKGLVERNKLDPGLVDDVITGCVT 59 M QAV + DA+R+P G+ K A + + A ++ L +R LD VDDV+ GC Sbjct: 1 MSQAVFIYDAVRTPRGKGKKDGALYSVKPVHMAAGLLTELQQRYDLDTSRVDDVVLGCGQ 60 Query: 60 QAGEQSAGPGRVAWLAAGFPDHVPATTIDRKCGSSQQAVHFAAQGIMAGAYDIVIACGIE 119 GEQ + AG+ + VP IDR C S +AV+ AA I +G D+++A G+E Sbjct: 61 PVGEQGGDVAKCVVQYAGWDESVPGVQIDRFCASGLEAVNQAASRIASGWEDLIVAGGVE 120 Query: 120 SMSRVPMGSARIGQNPYGPSMEARYAPGLVSQGVAAELVAAKYELSRHDMDSYSARSHEL 179 SMSR+PMG+A GQ + E + V QG+ A+L+AA SR D+D ++ S + Sbjct: 121 SMSRLPMGAA--GQ-AWIQDPEIAFKLQSVPQGIGADLLAALDGYSREDVDRFALVSQQR 177 Query: 180 AATARESGAFRREILGISTPNGLV--EQDETIRPGTSVEKLGTLQASFR-------NDEL 230 AA AR+SG F R ++ + NGLV E+DE I+P T++E L L+ SF +D Sbjct: 178 AAHARDSGYFDRSVVPVRDLNGLVVLERDEFIKPATTLEALSQLKPSFAAMGKLGYSDVA 237 Query: 231 SARFPQIGWNV---TAGNASQISDGASAMLLMSESMAQRLGLKPRARFVAFDVCGDDPVM 287 ++PQ+ TAGN+S I DGASA LL SE + Q+LGL PR R +A V +P + Sbjct: 238 LRKYPQVARIEPIHTAGNSSGIVDGASATLLGSERIGQQLGLAPRGRIIATAVLSTEPTL 297 Query: 288 MLTAPIPASQRAIKKSGLKLDQIDHYEINEAFACVPLAWQRALGADPARLNPRGGAIALG 347 ML P PA+++A+ K+GL + ID +EINEAFA V L + R L P N GGAIALG Sbjct: 298 MLAGPGPAAKKALAKAGLSVQDIDLFEINEAFASVVLRFMRDLDISPEITNVNGGAIALG 357 Query: 348 HPLGASGVRLMTTMLHALEDSGQRYGLQSMCEAGGMANATIIERL 392 HP+GA+G L+ T+L LE + GL ++C GGM ATIIERL Sbjct: 358 HPIGATGAMLVGTVLDELERRNLKRGLIALCVGGGMGIATIIERL 402 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 402 Length adjustment: 31 Effective length of query: 361 Effective length of database: 371 Effective search space: 133931 Effective search space used: 133931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory