Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate Pf6N2E2_229 Putative fumarylacetoacetate (FAA) hydrolase
Query= BRENDA::A0A076VF18 (308 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_229 Length = 283 Score = 100 bits (250), Expect = 3e-26 Identities = 77/244 (31%), Positives = 119/244 (48%), Gaps = 13/244 (5%) Query: 53 SPASTSS-PRVLTVQTLLSPLAPTDVPAIRGMGLQYSGDPANP-QDKPPVACLFFKASQA 110 SPA + PR+ P+ P + +G+ Y+ ++ P +F + + + Sbjct: 49 SPARLARLPRIPLADVTFLPVIPNPGKVLC-IGINYATHVRETGREMPTYPMIFTRFADS 107 Query: 111 LAGPGDDIVLPRLARDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLC 170 IV P + K D+E EL VV+GK A+ V DA+ +V GY ND S R Sbjct: 108 QTAHLQPIVRPTASH--KLDFEGELAVVIGKAARHVKHADALDYVAGYACYNDGSVRDWQ 165 Query: 171 AKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPE 230 Q+ GK++ FGP LV+ +G DP L +TT +NG++ Q T+D++ + + Sbjct: 166 KHTIQFVPGKNFPNTGGFGPWLVTGDEIG-DPQDLELTTRLNGEVMQHTRTSDMIFDVRQ 224 Query: 231 LIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQSP-FMKDGDEIRCFVEGCGTLINS 289 LI S T L G +I+TG+ +G A + P +MK GDE+ + GTL NS Sbjct: 225 LIEYCSTFTELAPGDVIVTGTTGGVG------AFREPPVWMKPGDEVEIEIARIGTLRNS 278 Query: 290 VRDE 293 + DE Sbjct: 279 IVDE 282 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 283 Length adjustment: 26 Effective length of query: 282 Effective length of database: 257 Effective search space: 72474 Effective search space used: 72474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory