GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fahA in Pseudomonas fluorescens FW300-N2E2

Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate Pf6N2E2_5291 Fumarylacetoacetase (EC 3.7.1.2)

Query= SwissProt::P16930
         (419 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 Fumarylacetoacetase
           (EC 3.7.1.2)
          Length = 434

 Score =  378 bits (971), Expect = e-109
 Identities = 207/420 (49%), Positives = 262/420 (62%), Gaps = 18/420 (4%)

Query: 10  SDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKH--LFTGPVLSKHQDVFNQPTL 67
           +DFP+ NLP G+FS  G    R GVAIG++I DL    H  LF G    +  +      L
Sbjct: 18  ADFPLQNLPLGIFSVDGGAL-RSGVAIGERIFDLQAALHAGLFDGAA-RQAVEAMADGQL 75

Query: 68  NSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQAS-ATMHLPATIGDYTD 126
           N F  LG+ A    R  L  LL    + LR + E +    +  A+   MHLPA I DYTD
Sbjct: 76  NGFFDLGRGARVALRERLLELLR-EDSPLRGEVEAQGAKLLLLAADCQMHLPARINDYTD 134

Query: 127 FYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSK 186
           FY   +HA NVG +FR  +N L+PN+ ++P+GYHGRAS++  SGT +RRP GQ  P    
Sbjct: 135 FYVGIEHAQNVGKLFRP-DNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQT 193

Query: 187 PPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVP 246
            P +G C  LD ELE+  ++G GN LGEPIPI  A EHI G  L+NDWSARDIQ WEY P
Sbjct: 194 EPTFGPCARLDYELELGIWIGKGNALGEPIPIGDAAEHIGGFCLLNDWSARDIQAWEYQP 253

Query: 247 LGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQ---DPRPLPYLCHDEPY---TFDINLS 300
           LGPFL KSF T++SPWVV  +AL PF  P P +   DP+PLPYL          FDI L 
Sbjct: 254 LGPFLSKSFLTSISPWVVTAEALEPFRRPQPARPQGDPQPLPYLLDKRDQAGGAFDIELE 313

Query: 301 VNLKGEGMSQ----AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEP 356
           V L  E M +    A  +  SN +YMYWT+ Q + HHSVNGC L+ GDL  SGT+SGPE 
Sbjct: 314 VLLLTEAMGEQNLPAQRLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPEN 373

Query: 357 ENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGY-RIGFGQCAGKVLPA 415
             FGS+LE++  G KPI+L +G+ R+FL DGDE+I+   C+ +G+  IGFG+C GK+LPA
Sbjct: 374 HQFGSLLEITEGGKKPIELASGEVRRFLEDGDEIILRARCRREGFASIGFGECRGKILPA 433


Lambda     K      H
   0.321    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 616
Number of extensions: 41
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 419
Length of database: 434
Length adjustment: 32
Effective length of query: 387
Effective length of database: 402
Effective search space:   155574
Effective search space used:   155574
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate Pf6N2E2_5291 (Fumarylacetoacetase (EC 3.7.1.2))
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01266.hmm
# target sequence database:        /tmp/gapView.27983.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01266  [M=420]
Accession:   TIGR01266
Description: fum_ac_acetase: fumarylacetoacetase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   1.3e-193  629.5   0.0   1.4e-193  629.4   0.0    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291  Fumarylacetoacetase (EC 3.7.1.2)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291  Fumarylacetoacetase (EC 3.7.1.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  629.4   0.0  1.4e-193  1.4e-193       1     419 [.       9     433 ..       9     434 .] 0.96

  Alignments for each domain:
  == domain 1  score: 629.4 bits;  conditional E-value: 1.4e-193
                                      TIGR01266   1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevf 63 
                                                    s+va a+ ++dfplqnlP+G+fs   +   r gvaiG++i+dl+++++aglf+g a++++ e++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291   9 SWVACANgHADFPLQNLPLGIFS-VDGGALRSGVAIGERIFDLQAALHAGLFDG-AARQAVEAM 70 
                                                    8******9***************.56677889**********************.89999**** PP

                                      TIGR01266  64 kestlnaflalgrparkevrerlqkllsesaevlrdnaalr.keallaqaeatmhlPaqiGdyt 126
                                                     ++ ln f+ lgr ar+++rerl++ll e++  lr + + +  ++ll +a+++mhlPa+i dyt
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291  71 ADGQLNGFFDLGRGARVALRERLLELLREDSP-LRGEVEAQgAKLLLLAADCQMHLPARINDYT 133
                                                    ****************************7765.5777665527899999*************** PP

                                      TIGR01266 127 dfyssirhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePv 190
                                                    dfy++i+ha+nvG+lfr +dn+llPnyk++P+gyhGras+++ sGt++rrP+Gq+++++  eP+
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 134 DFYVGIEHAQNVGKLFR-PDNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQTEPT 196
                                                    *****************.********************************************** PP

                                      TIGR01266 191 fgpckkldlelelaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflak 254
                                                    fgpc++ld+elel++++g++n+lGe++pi  a+ehi G++llndwsardiqawey+PlGPfl+k
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 197 FGPCARLDYELELGIWIGKGNALGEPIPIGDAAEHIGGFCLLNDWSARDIQAWEYQPLGPFLSK 260
                                                    **************************************************************** PP

                                      TIGR01266 255 sfattvsPwvvsiealePfrvaq.lePeqdpkplpylredr..adtafdielevslkteGlae. 314
                                                    sf t++sPwvv++ealePfr++q ++P++dp+plpyl ++r  a  afdielev l te ++e 
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 261 SFLTSISPWVVTAEALEPFRRPQpARPQGDPQPLPYLLDKRdqAGGAFDIELEVLLLTEAMGEq 324
                                                    ***********************9***************99546689*************9998 PP

                                      TIGR01266 315 ...aavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkk 375
                                                       a++++ sn++ +ywt++q++ahhsvnGc+l+aGdl+gsGt+sG+e+++fGslle++ +Gkk
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 325 nlpAQRLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPENHQFGSLLEITEGGKK 388
                                                    89889*********************************************************** PP

                                      TIGR01266 376 evkladgetrkfledGdevilrgvckkeGvr.vGfGecaGkvlpa 419
                                                    +++la+ge+r+fledGde+ilr++c++eG   +GfGec+Gk+lpa
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 389 PIELASGEVRRFLEDGDEIILRARCRREGFAsIGFGECRGKILPA 433
                                                    *****************************988************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (420 nodes)
Target sequences:                          1  (434 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.87
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory