Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate Pf6N2E2_5291 Fumarylacetoacetase (EC 3.7.1.2)
Query= SwissProt::P16930 (419 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 Length = 434 Score = 378 bits (971), Expect = e-109 Identities = 207/420 (49%), Positives = 262/420 (62%), Gaps = 18/420 (4%) Query: 10 SDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKH--LFTGPVLSKHQDVFNQPTL 67 +DFP+ NLP G+FS G R GVAIG++I DL H LF G + + L Sbjct: 18 ADFPLQNLPLGIFSVDGGAL-RSGVAIGERIFDLQAALHAGLFDGAA-RQAVEAMADGQL 75 Query: 68 NSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQAS-ATMHLPATIGDYTD 126 N F LG+ A R L LL + LR + E + + A+ MHLPA I DYTD Sbjct: 76 NGFFDLGRGARVALRERLLELLR-EDSPLRGEVEAQGAKLLLLAADCQMHLPARINDYTD 134 Query: 127 FYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSK 186 FY +HA NVG +FR +N L+PN+ ++P+GYHGRAS++ SGT +RRP GQ P Sbjct: 135 FYVGIEHAQNVGKLFRP-DNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQT 193 Query: 187 PPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVP 246 P +G C LD ELE+ ++G GN LGEPIPI A EHI G L+NDWSARDIQ WEY P Sbjct: 194 EPTFGPCARLDYELELGIWIGKGNALGEPIPIGDAAEHIGGFCLLNDWSARDIQAWEYQP 253 Query: 247 LGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQ---DPRPLPYLCHDEPY---TFDINLS 300 LGPFL KSF T++SPWVV +AL PF P P + DP+PLPYL FDI L Sbjct: 254 LGPFLSKSFLTSISPWVVTAEALEPFRRPQPARPQGDPQPLPYLLDKRDQAGGAFDIELE 313 Query: 301 VNLKGEGMSQ----AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEP 356 V L E M + A + SN +YMYWT+ Q + HHSVNGC L+ GDL SGT+SGPE Sbjct: 314 VLLLTEAMGEQNLPAQRLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPEN 373 Query: 357 ENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGY-RIGFGQCAGKVLPA 415 FGS+LE++ G KPI+L +G+ R+FL DGDE+I+ C+ +G+ IGFG+C GK+LPA Sbjct: 374 HQFGSLLEITEGGKKPIELASGEVRRFLEDGDEIILRARCRREGFASIGFGECRGKILPA 433 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 616 Number of extensions: 41 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 434 Length adjustment: 32 Effective length of query: 387 Effective length of database: 402 Effective search space: 155574 Effective search space used: 155574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate Pf6N2E2_5291 (Fumarylacetoacetase (EC 3.7.1.2))
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.17439.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-193 629.5 0.0 1.4e-193 629.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 Fumarylacetoacetase (EC 3.7.1.2) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 Fumarylacetoacetase (EC 3.7.1.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 629.4 0.0 1.4e-193 1.4e-193 1 419 [. 9 433 .. 9 434 .] 0.96 Alignments for each domain: == domain 1 score: 629.4 bits; conditional E-value: 1.4e-193 TIGR01266 1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevf 63 s+va a+ ++dfplqnlP+G+fs + r gvaiG++i+dl+++++aglf+g a++++ e++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 9 SWVACANgHADFPLQNLPLGIFS-VDGGALRSGVAIGERIFDLQAALHAGLFDG-AARQAVEAM 70 8******9***************.56677889**********************.89999**** PP TIGR01266 64 kestlnaflalgrparkevrerlqkllsesaevlrdnaalr.keallaqaeatmhlPaqiGdyt 126 ++ ln f+ lgr ar+++rerl++ll e++ lr + + + ++ll +a+++mhlPa+i dyt lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 71 ADGQLNGFFDLGRGARVALRERLLELLREDSP-LRGEVEAQgAKLLLLAADCQMHLPARINDYT 133 ****************************7765.5777665527899999*************** PP TIGR01266 127 dfyssirhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePv 190 dfy++i+ha+nvG+lfr +dn+llPnyk++P+gyhGras+++ sGt++rrP+Gq+++++ eP+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 134 DFYVGIEHAQNVGKLFR-PDNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQTEPT 196 *****************.********************************************** PP TIGR01266 191 fgpckkldlelelaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflak 254 fgpc++ld+elel++++g++n+lGe++pi a+ehi G++llndwsardiqawey+PlGPfl+k lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 197 FGPCARLDYELELGIWIGKGNALGEPIPIGDAAEHIGGFCLLNDWSARDIQAWEYQPLGPFLSK 260 **************************************************************** PP TIGR01266 255 sfattvsPwvvsiealePfrvaq.lePeqdpkplpylredr..adtafdielevslkteGlae. 314 sf t++sPwvv++ealePfr++q ++P++dp+plpyl ++r a afdielev l te ++e lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 261 SFLTSISPWVVTAEALEPFRRPQpARPQGDPQPLPYLLDKRdqAGGAFDIELEVLLLTEAMGEq 324 ***********************9***************99546689*************9998 PP TIGR01266 315 ...aavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkk 375 a++++ sn++ +ywt++q++ahhsvnGc+l+aGdl+gsGt+sG+e+++fGslle++ +Gkk lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 325 nlpAQRLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPENHQFGSLLEITEGGKK 388 89889*********************************************************** PP TIGR01266 376 evkladgetrkfledGdevilrgvckkeGvr.vGfGecaGkvlpa 419 +++la+ge+r+fledGde+ilr++c++eG +GfGec+Gk+lpa lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5291 389 PIELASGEVRRFLEDGDEIILRARCRREGFAsIGFGECRGKILPA 433 *****************************988************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (434 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory