GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mmsA in Pseudomonas fluorescens FW300-N2E2

Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate Pf6N2E2_515 Methylmalonate-semialdehyde dehydrogenase [inositol] (EC 1.2.1.27)

Query= BRENDA::G5CZI2
         (498 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515
           Methylmalonate-semialdehyde dehydrogenase [inositol] (EC
           1.2.1.27)
          Length = 500

 Score =  615 bits (1585), Expect = e-180
 Identities = 296/494 (59%), Positives = 382/494 (77%), Gaps = 3/494 (0%)

Query: 4   IGHLINGQLVT-ENTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPL 62
           +GH +NG +   ++TR  NVFNPATG +  ++ LA   TV+ A+++A  AFP W     L
Sbjct: 7   VGHYLNGHVQDHDSTRFSNVFNPATGAVQARVALAEPGTVDAAVASALAAFPAWSEQSSL 66

Query: 63  KRARVMFRFKELLEQHADEICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEH 122
           +R+RVMF+FKELL++H DE+ ++I  EHGK+  DA GE+ RGIE VEYACGAP LLK + 
Sbjct: 67  RRSRVMFKFKELLDRHHDELAQIISREHGKVLSDAHGEVTRGIEIVEYACGAPNLLKTDF 126

Query: 123 SRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLWMFPMAIVCGNCFVLKPSERDPSSTL 182
           S N+G GID+W+  QP+GV AG+TPFNFPVMVPLWM P+A+V GNCF+LKPSERDPS++L
Sbjct: 127 SDNIGGGIDNWNLRQPLGVCAGVTPFNFPVMVPLWMIPLALVAGNCFILKPSERDPSASL 186

Query: 183 YIAQLLQEAGLPDGVMNVVNGDKEAVDALLHDDRVKAVSFVGSTPIAEYIYRTASANGKR 242
            +A+LL EAGLPDGV NVV GDK AVDALL    ++A+SFVGSTPIAEYI++  +A+GKR
Sbjct: 187 LMARLLTEAGLPDGVFNVVQGDKVAVDALLQHPDIEAISFVGSTPIAEYIHQQGTAHGKR 246

Query: 243 CQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSVAVAVGDAAGDALVSKMT 302
            QALGGAKNH IVMPDAD+D A + L+GAA+GS+GERCMA+S+AVAVGD  GD L++K+ 
Sbjct: 247 VQALGGAKNHMIVMPDADLDQAADALIGAAYGSAGERCMAISIAVAVGD-VGDELIAKLL 305

Query: 303 QAMQKLKVGPSTDSGNDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVPNHENGF 362
             + +LK+G     G D GP++T +H+ KV G+I++   +GA ++VDGR  KVP  E GF
Sbjct: 306 PRIDQLKIGNGQQPGTDMGPLVTAEHKAKVEGFIDAGVAEGARLIVDGRSFKVPGAEQGF 365

Query: 363 FVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAMDLIDAHEYGNGTCIFTRDGEAA 422
           FVG TL D VT EM+ YQ+EIFGPVL +VRV     A+ LI+AHE+GNG   FTRDG  A
Sbjct: 366 FVGATLFDQVTAEMSIYQQEIFGPVLGIVRVPDFATAVALINAHEFGNGVSCFTRDGGIA 425

Query: 423 RYFSDNIQVGMVGINIPLPVPVAYHSFGGWKRSLFGDLHAYGPDAVRFYTKRKTVTQRWP 482
           R F+ +I+VGMVGIN+P+PVP+A+HSFGGWKRSLFGD HAYG + +RFY++ K+V QRWP
Sbjct: 426 RAFARSIKVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGLRFYSRYKSVMQRWP 485

Query: 483 SAGVREGAEFSMPT 496
            + + +G EFSMPT
Sbjct: 486 DS-IAKGPEFSMPT 498


Lambda     K      H
   0.319    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 770
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 498
Length of database: 500
Length adjustment: 34
Effective length of query: 464
Effective length of database: 466
Effective search space:   216224
Effective search space used:   216224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate Pf6N2E2_515 (Methylmalonate-semialdehyde dehydrogenase [inositol] (EC 1.2.1.27))
to HMM TIGR01722 (mmsA: methylmalonate-semialdehyde dehydrogenase (acylating) (EC 1.2.1.27))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01722.hmm
# target sequence database:        /tmp/gapView.16634.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01722  [M=477]
Accession:   TIGR01722
Description: MMSDH: methylmalonate-semialdehyde dehydrogenase (acylating)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   2.7e-212  691.6   0.1   3.1e-212  691.4   0.1    1.0  1  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515  Methylmalonate-semialdehyde dehy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515  Methylmalonate-semialdehyde dehydrogenase [inositol] (EC 1.2.1.27)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  691.4   0.1  3.1e-212  3.1e-212       1     477 []       7     484 ..       7     484 .. 1.00

  Alignments for each domain:
  == domain 1  score: 691.4 bits;  conditional E-value: 3.1e-212
                                     TIGR01722   1 vkhlidGkfvegksdkyipvsnpatnevlakvaeasaeevdaavasaretfaawaetsvaerarv 65 
                                                   v h+++G++ +  s+++ +v npat+ v a+va a    vdaavasa  +f+aw+e s ++r+rv
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515   7 VGHYLNGHVQDHDSTRFSNVFNPATGAVQARVALAEPGTVDAAVASALAAFPAWSEQSSLRRSRV 71 
                                                   679************************************************************** PP

                                     TIGR01722  66 llryqallkehrdeiaklisaeqGktledakGdvarGlevvehacsvtslllGetvesvakdvdv 130
                                                   ++++++ll+ h+de+a++is e+Gk+l+da+G+v rG+e+ve+ac+ + ll+ + ++++   +d 
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515  72 MFKFKELLDRHHDELAQIISREHGKVLSDAHGEVTRGIEIVEYACGAPNLLKTDFSDNIGGGIDN 136
                                                   ***************************************************************** PP

                                     TIGR01722 131 ysirqplGvvaGitpfnfpamiplwmfplaiacGntfvlkpsekvpsaavklaellseaGapdGv 195
                                                   + +rqplGv+aG+tpfnfp m+plwm pla++ Gn+f+lkpse++psa++ +a+ll+eaG+pdGv
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 137 WNLRQPLGVCAGVTPFNFPVMVPLWMIPLALVAGNCFILKPSERDPSASLLMARLLTEAGLPDGV 201
                                                   ***************************************************************** PP

                                     TIGR01722 196 lnvvhGdkeavdrllehpdvkavsfvGsvavgeyiyetgsahgkrvqalaGaknhmvvlpdadke 260
                                                   +nvv Gdk+avd ll+hpd+ a+sfvGs++++eyi+++g+ahgkrvqal+Gaknhm+v+pdad++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 202 FNVVQGDKVAVDALLQHPDIEAISFVGSTPIAEYIHQQGTAHGKRVQALGGAKNHMIVMPDADLD 266
                                                   ***************************************************************** PP

                                     TIGR01722 261 aaldalvgaavGaaGqrcmaisaavlvGaa.kelveeireraekvrvgagddpgaelGplitkqa 324
                                                   +a+dal+gaa+G+aG+rcmais+av+vG++ +el+ ++  r++++++g g++pg+++Gpl+t ++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 267 QAADALIGAAYGSAGERCMAISIAVAVGDVgDELIAKLLPRIDQLKIGNGQQPGTDMGPLVTAEH 331
                                                   ******************************9********************************** PP

                                     TIGR01722 325 kervasliasgakeGaevlldGrgykveGyeeGnfvGitllervkpdmkiykeeifGpvlvvlea 389
                                                   k++v+ +i++g++eGa++++dGr++kv G e+G fvG tl+++v ++m+iy++eifGpvl ++++
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 332 KAKVEGFIDAGVAEGARLIVDGRSFKVPGAEQGFFVGATLFDQVTAEMSIYQQEIFGPVLGIVRV 396
                                                   ***************************************************************** PP

                                     TIGR01722 390 dtleeaiklinespyGnGtaiftsdGaaarkfqheievGqvGvnvpipvplpffsftGwkdslfG 454
                                                     +  a++lin+  +GnG + ft+dG+ ar f   i+vG+vG+nvpipvp++++sf+Gwk slfG
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 397 PDFATAVALINAHEFGNGVSCFTRDGGIARAFARSIKVGMVGINVPIPVPMAWHSFGGWKRSLFG 461
                                                   ***************************************************************** PP

                                     TIGR01722 455 dlhiyGkqGvrfytrlktvtarw 477
                                                   d+h+yG++G+rfy+r k v  rw
  lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_515 462 DHHAYGEEGLRFYSRYKSVMQRW 484
                                                   **********************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (477 nodes)
Target sequences:                          1  (500 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 7.38
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory