Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate Pf6N2E2_1929 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1929 Length = 444 Score = 132 bits (332), Expect = 1e-35 Identities = 82/273 (30%), Positives = 138/273 (50%), Gaps = 10/273 (3%) Query: 1 MRIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTVLAELAELGGQISPSPKDAAANSELV 60 M+I +IGLG +G+ +AR + H L ++D+N + +LG ++P+ D A +++ Sbjct: 1 MKIGYIGLGALGSQLARRFLS--HSLCVWDINTAAVDTFKKLGADVAPTAADLARRCDVI 58 Query: 61 ITMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMGDAPV 120 LP ++ VRS +G+ AG+ PGT +D ++ P R +++ A +G+DM DA V Sbjct: 59 FLCLPRSSDVRSALFGPNGLAAGLVPGTLIIDQTSGIPGETRRMAEELAERGIDMMDAAV 118 Query: 121 SGGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGE-VGTGQIAKICNNLLLGI 179 S A G T MV ++ PVL+ + + I CGE VG GQ K+ NN + Sbjct: 119 SASPLVVAEGKATLMVAGPDTVYERALPVLQVITQTIYRCGERVGDGQAMKMVNNAMNAG 178 Query: 180 SMIGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDTYNPWPGIIETAPASRGYTGGFG 239 +G E +A+G G+ ++A ++N + R ++D P + + P++ F Sbjct: 179 CRLGTLEVVAMGKKAGLSLPLMADVLNRNKARNQTTD--RMLPALAQGKPST-----NFA 231 Query: 240 AELMLKDLGLATEAARQAHQPVILGAVAQQLYQ 272 LMLKD+ A P+ L A+ + L Q Sbjct: 232 LALMLKDVDQAVALGMSRDVPMPLTALVRALLQ 264 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 444 Length adjustment: 29 Effective length of query: 266 Effective length of database: 415 Effective search space: 110390 Effective search space used: 110390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory