Align SDR family oxidoreductase (characterized, see rationale)
to candidate Pf6N2E2_1004 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1004 Length = 252 Score = 144 bits (364), Expect = 1e-39 Identities = 99/254 (38%), Positives = 144/254 (56%), Gaps = 24/254 (9%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTDD 66 RL K L+T GIGRA ELFA EGA VI D+ H E V LDV+ Sbjct: 14 RLHNKVALVTGGGMGIGRAIAELFAEEGATVIVGDV---HQPEPYKNDSVVAKHLDVSKL 70 Query: 67 DAIKALVAKV----GTVDVLFNCAGYVAAGNILECDDKA---WDFSFNLNAKAMFHTIRA 119 + + LVA+V G VDVL N AG V G+ L D+ W+ ++N +F+ +R Sbjct: 71 EDWELLVAEVVREHGKVDVLVNNAGLV--GSYLPIDEITLDDWNRVIDINQNGVFYGMRT 128 Query: 120 VLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAI 179 V+P M + AGSIVN++S V G + AY ASKAAV ++K+ A +V+ GIR N++ Sbjct: 129 VVPVMKRQHAGSIVNVSSIWGIV-GASGVSAYQASKAAVRMMSKNAALSYVANGIRVNSL 187 Query: 180 CPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESN 239 PG +E+P ++++ + ++ AA VA PM R +E+A AL+LASDE++ Sbjct: 188 HPGLVETPMIDRQAA-----------DITAAVVAATPMKRAADPKEIAYAALFLASDEAS 236 Query: 240 FTTGSIHMIDGGWS 253 F TG+ ++DGG++ Sbjct: 237 FITGAELVVDGGYT 250 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 252 Length adjustment: 24 Effective length of query: 230 Effective length of database: 228 Effective search space: 52440 Effective search space used: 52440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory