Align 2-keto-3-deoxyxylonate dehydratase (EC 4.2.1.141) (characterized)
to candidate Pf6N2E2_862 Fumarylacetoacetate hydrolase family protein
Query= reanno::HerbieS:HSERO_RS19360 (391 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_862 Length = 392 Score = 457 bits (1177), Expect = e-133 Identities = 237/383 (61%), Positives = 283/383 (73%), Gaps = 4/383 (1%) Query: 11 LPEDHAQATLIGRIWQPGV--GPVLVRIDADGAYDLTLIAATSSELLELDNPAAAVRSAT 68 LP D TLIGR W PG GP V + +G +DL+ +T SELLE +P VR A Sbjct: 12 LPVDGLAGTLIGRAWIPGAIAGPSPVVLRDEGVFDLSETFSTISELLEHTSPLLVVRQAP 71 Query: 69 NMTRIATLQELLDNADAAGRDTSRPWLLAPIDLQAVKASGVTFVASMLERVIEEQARGDA 128 I T++ LL N + D + LL P DLQ +KA+GVTF +SM+ERVIEEQARGDA Sbjct: 72 GRY-IGTVEALLGNTGSHA-DPGKASLLPPADLQVIKAAGVTFASSMIERVIEEQARGDA 129 Query: 129 GKAESVRKAITAVIGDNLSSVVPGSPEAARLKEVLLDQGVWSQYLEVGIGPDAEIFTKAQ 188 KAESVR+ + IGDNL ++ PGSPEA RLK VL+ QG+WSQYLEVGIGPDAEIFTKA Sbjct: 130 AKAESVRRLVHEAIGDNLRAIKPGSPEAMRLKAVLIKQGMWSQYLEVGIGPDAEIFTKAP 189 Query: 189 PMSSVGLGDEVGIHPKSAWNNPEPEIVLAINSRGKVVGATLGNDVNLRDFEGRSALLLGK 248 +++VG G E+GIH KS WNNPEPEIVLA+NSRG+V G TLGNDVNLRDFEGRSALLL K Sbjct: 190 VLAAVGSGSEIGIHRKSEWNNPEPEIVLAVNSRGQVHGVTLGNDVNLRDFEGRSALLLSK 249 Query: 249 AKDNNASCAVGPFIRLFDANFSIDDVRRAELTMRVDGTEGFTLKGSSSMSMISRDPLQLV 308 AKDNNASCA+GPFIRLFD F++DDVR + + V G +GF L+GSSSM++ISRDPL LV Sbjct: 250 AKDNNASCAIGPFIRLFDEAFTLDDVRNCVVDLHVQGDDGFALEGSSSMALISRDPLDLV 309 Query: 309 EHAIGPNHQYPDGLVLFLGTMFAPTQDRFGPGQGFTHQVADIVTISTPKLGALVNTVNFS 368 +G +HQYPDG +LFLGT+FAPTQDR PG GFTH+ D V+I +P LG L NTV +S Sbjct: 310 AQTVGGDHQYPDGFMLFLGTLFAPTQDREEPGSGFTHKQGDEVSIGSPLLGTLRNTVTYS 369 Query: 369 DQTAPWTFGLTALFKNLADRKLI 391 + APWTFGL A+ NLA R L+ Sbjct: 370 HEAAPWTFGLRAMMHNLAARGLL 392 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 392 Length adjustment: 31 Effective length of query: 360 Effective length of database: 361 Effective search space: 129960 Effective search space used: 129960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory