Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate Pf6N2E2_1443 putative aldo/keto reductase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1443 Length = 335 Score = 174 bits (442), Expect = 2e-48 Identities = 113/312 (36%), Positives = 170/312 (54%), Gaps = 21/312 (6%) Query: 26 VALGTWAIGG----WMWGGTDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIK 81 + LGTWAI G + WG DD+ S+ + A++ G+N IDTA YG GHAE +VG+ ++ Sbjct: 16 IGLGTWAIAGTGWEYSWGAQDDEDSLGALEYAVECGVNWIDTAAIYGLGHAEHLVGQLLR 75 Query: 82 ----GQRDNLIIATKVGLDWTLTPDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHW 137 QR ++ TK L W +++ + + + E+E SLRRL + +DLYQ+HW Sbjct: 76 RLPASQRP--LVFTKGSLVWDPVT-KAISHSLAPQSLLAEVEASLRRLQVETLDLYQIHW 132 Query: 138 P-----DPLVPIEETATILEALRKEGKIRSIGVSNYSVQQMDEFKKYAELAVSQSPYNLF 192 P +E+ + L R++GKIR+IGVSN+ V Q+ E+ Q PY++ Sbjct: 133 PAFPADGSSEGLEQALSALATAREQGKIRAIGVSNFDVAQLKRALAVTEIVSLQPPYSVL 192 Query: 193 EREIDKDILPYAKKNDLVVLGYGALCRGLLSGRMTADR--AFTGDDLRKT-DPKFQKPRF 249 R+I++D+LP+ + + VL Y L GLLSG MT R DD RK FQ+PR Sbjct: 193 MRDIEEDVLPFCEHTGMGVLAYSTLQSGLLSGSMTRQRIAQLPDDDWRKARSADFQEPRL 252 Query: 250 EHYLAAVEELKKLAKEHYNKSVLALAIRWMLEQG-PTLALWGACKPEQIDGIDEVFGWQI 308 LA VE L + + H S A+AI W+L + T A+ GA Q+DG+ ++ Sbjct: 253 SANLALVEVLAGIGERH-GVSAAAVAIAWVLRKPVVTGAIVGARCRGQVDGLIAGAQLRL 311 Query: 309 SDEDLKQIDAIL 320 S E++++I L Sbjct: 312 SAEEIEEIRPFL 323 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 335 Length adjustment: 28 Effective length of query: 312 Effective length of database: 307 Effective search space: 95784 Effective search space used: 95784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory