Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized)
to candidate 208332 DVU2823 TRAP dicarboxylate transporter family protein
Query= reanno::PV4:5208943 (465 letters) >MicrobesOnline__882:208332 Length = 591 Score = 291 bits (745), Expect = 4e-83 Identities = 157/456 (34%), Positives = 261/456 (57%), Gaps = 36/456 (7%) Query: 3 IATLFISLFLCMLLGMPIAIALGFSSMLTILLFSDDSLASVALKLYESTSEHYTLLAIPF 62 + LF + + +G+PIAI LG +++ TI+ + +A + S + + ++AIPF Sbjct: 171 LPVLFGYFAIFLAVGVPIAIGLGLAALATIIAAGTLPIEYIAQVAFTSI-DSFPIMAIPF 229 Query: 63 FILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIGSI 122 FI + F+ GG++RR++ A + +G + GG+A+A++ CM FAA+SGS PATVAAIGS+ Sbjct: 230 FIAAGVFMGAGGLSRRLLTLADEMLGSLHGGMALATIGTCMFFAAISGSGPATVAAIGSL 289 Query: 123 VIVGMVRAGYPEKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGLMM 182 I MV GY + F+A V+ +G +G++IPPS +VY + +VS ++F+ G++PG++ Sbjct: 290 TIPAMVERGYDKYFSAAVVAAAGAIGVMIPPSNPFVVYGVSAQVSIGKLFLGGIVPGVLT 349 Query: 183 GLLLMLAIYIVARIKKLPSR-PFPGFRPLAISSAKAMGGLALIVIVLGSIYGGIASPTEA 241 GL LM+ Y ++ + R + A L + VIVLG IYGGI +PTEA Sbjct: 350 GLALMVYSYWYSKKRGWKGEVRVRNLRTFTRALWDAKWALMVPVIVLGGIYGGIMTPTEA 409 Query: 242 AAVACVYAYFIAVFGYRDIGPLKNVSWRDSGEPLIRAILRNLGFMVLAVFKTPADKEIRH 301 AA+A Y F+ F +R++ N G + Sbjct: 410 AALAAFYGLFVGCFIHREL---------------------NCG-------------SLYD 435 Query: 302 VVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHLIAETIVGMGLPVWGFLIIVNLLLLAA 361 + + A S +++ ++A A +F +++T E +P IA ++ + L+++N+LL+ Sbjct: 436 CIVEAAGTSAVVIVLMAMATIFGNIMTIEEVPTAIATAMLNLTENKIAILMLINVLLIVI 495 Query: 362 GNFMEPSAILLIMAPILFPIATQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTAGITG 421 G FME A ++I+ PIL PI ++G+DP+H G+IMVVN+ IG + PPVG+NLFV +G+ Sbjct: 496 GTFMEALAAIVILTPILLPIVLKVGVDPVHFGVIMVVNLAIGFVPPPVGVNLFVASGVAH 555 Query: 422 RSMGWVIHSCIPWLALLLFFLALITYIPQISLFLPE 457 + + +P +A+++ L LITY+P + +FL E Sbjct: 556 AKIEHLSKVVMPLIAIMIGVLLLITYVPALPMFLAE 591 Lambda K H 0.330 0.144 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 728 Number of extensions: 49 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 465 Length of database: 591 Length adjustment: 35 Effective length of query: 430 Effective length of database: 556 Effective search space: 239080 Effective search space used: 239080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory