Align BadH (characterized)
to candidate 208656 DVU3137 oxidoreductase, short chain dehydrogenase/reductase family
Query= metacyc::MONOMER-893 (255 letters) >MicrobesOnline__882:208656 Length = 258 Score = 134 bits (338), Expect = 1e-36 Identities = 85/248 (34%), Positives = 120/248 (48%), Gaps = 7/248 (2%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCD 63 +Q++ ++TG GIG FA GA++ + DL+ + E A R G D Sbjct: 5 MQDRRVMVTGSAKGIGKGIAEAFASRGARVFLADLSAEHVEATGNAFRAKGYNVAWGVAD 64 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHH 123 + D+ SV+ + LG +D+L NAG P +W+ ++ +NL G Sbjct: 65 VKDKASVEQVASKAVEQLGGLDVLCANAGIFPAAPLETMTEEQWDTVLDVNLKGMFLTVQ 124 Query: 124 AVLPGMVERRHGRIVNIASDAARV-GSSGEAVYAACKGGLVAFSKTLAREHARHGITVNV 182 A +P + E GRIV +S V G G Y A K G + F +T A E AR+GIT+N Sbjct: 125 ACIPALKESTSGRIVVTSSITGPVTGYPGWCHYGASKAGQMGFIRTAAIELARYGITINA 184 Query: 183 VCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITG 242 V PG T L + E + + +IPL RLG P D+A A F S DAG+ITG Sbjct: 185 VQPGNIATEGLQE------QGEAYMASMASSIPLRRLGLPADIAAAAVFLASPDAGYITG 238 Query: 243 QVLSVSGG 250 Q + V GG Sbjct: 239 QGIIVDGG 246 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 258 Length adjustment: 24 Effective length of query: 231 Effective length of database: 234 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory