Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate 206141 DVU0716 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >MicrobesOnline__882:206141 Length = 238 Score = 237 bits (604), Expect = 2e-67 Identities = 127/235 (54%), Positives = 167/235 (71%), Gaps = 2/235 (0%) Query: 2 LKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITFE 61 L++ +H YG +EAL G+DI + GEIV+++GANGAGK+T LM+I G + G + F Sbjct: 3 LELRNLHVKYGNVEALHGIDIRVDEGEIVTILGANGAGKTTTLMSISGLVKPSEGGVFFR 62 Query: 62 GQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAK-PGSFANELERVLTLF 120 + + ++ ++E+V GI QSPEGRR+F +SVLENL +G+ T + L + LF Sbjct: 63 DEPLHKLHSHEVVARGITQSPEGRRVFGTLSVLENLYLGAFTCRDKARVERTLGWIFELF 122 Query: 121 PRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDIN 180 PRL+ER Q AGT+SGGEQQMLAIGRALM P++LLLDEPSLGLAP++VK IF V+ IN Sbjct: 123 PRLEERRGQLAGTLSGGEQQMLAIGRALMGDPKVLLLDEPSLGLAPILVKSIFDTVRTIN 182 Query: 181 REQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYLEGG 235 + +TV +VEQNA ALKLA RGYVM G+V M + A LLAN EV++AYL GG Sbjct: 183 -QSGVTVVLVEQNARAALKLATRGYVMEVGRVVMEDSAASLLANPEVQAAYLGGG 236 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 238 Length adjustment: 23 Effective length of query: 213 Effective length of database: 215 Effective search space: 45795 Effective search space used: 45795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory