Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate 207828 DVU2341 amino acid ABC transproter, permease protein, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >MicrobesOnline__882:207828 Length = 233 Score = 105 bits (262), Expect = 1e-27 Identities = 59/126 (46%), Positives = 80/126 (63%), Gaps = 1/126 (0%) Query: 242 ELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVII 301 E A ++LTVYTAAFIAE +RSGI S+ Q EA+R+ GL + V++PQA R+I+ Sbjct: 100 EFAAGVISLTVYTAAFIAEEIRSGIFSIPRTQLEASRACGLSFMQAMSYVVLPQAFRIIV 159 Query: 302 PPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISL 361 PPL SQ LNL KNSSL IG E+ + A + + T E ++ +YL IS+ +SL Sbjct: 160 PPLISQALNLFKNSSLCMTIGVMEL-TYMARQIESYTFHGFEAFTVSTLIYLCISLMVSL 218 Query: 362 LMNWYN 367 L+N YN Sbjct: 219 LINLYN 224 Score = 47.8 bits (112), Expect = 3e-10 Identities = 24/66 (36%), Positives = 37/66 (56%) Query: 69 GLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLLQILFWYFA 128 G++ T ++ + ++LA +LG +I V RLS + + E FRN P L+QI FWYF Sbjct: 22 GVITTCQLSGLSLVLAMLLGTLIAVMRLSGVRPFVWFSVAFTEFFRNTPLLVQIFFWYFG 81 Query: 129 VFLSMP 134 +P Sbjct: 82 SDAVLP 87 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 233 Length adjustment: 26 Effective length of query: 349 Effective length of database: 207 Effective search space: 72243 Effective search space used: 72243 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory