Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate 207827 DVU2340 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >MicrobesOnline__882:207827 Length = 230 Score = 134 bits (338), Expect = 2e-36 Identities = 77/204 (37%), Positives = 122/204 (59%), Gaps = 4/204 (1%) Query: 156 GGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSV 215 GG+ +++++A GI GA LG+ L R S +R + ++E RG+PL+ ++F Sbjct: 24 GGMAMSILLAIGGIFGAFWLGLAFGLMRLSEKWWVRAPAIVYVEVIRGIPLLMLIFWFYF 83 Query: 216 MLPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSM 275 + P+ L G + ALI I+F AYIAE+VR G+ A+P GQ EAA GL ++M Sbjct: 84 LAPIAL--GHTLPEAESALIAFIVFTGAYIAEIVRAGVLALPAGQMEAARGTGLSKTQAM 141 Query: 276 GLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYV 335 VILPQAL+ +IP VN F++L KDTSL IIG+ +L + Q + + L TE ++ Sbjct: 142 LFVILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVSELTRTATQ--VNNRTLTAPTEIFL 199 Query: 336 FAALVFWIFCFGMSRYSMHLERKL 359 AL++++ C+ ++ S LE+++ Sbjct: 200 TIALMYFVICWVLTATSRRLEKQM 223 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 230 Length adjustment: 26 Effective length of query: 339 Effective length of database: 204 Effective search space: 69156 Effective search space used: 69156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory