GapMind for catabolism of small carbon sources

 

Alignments for a candidate for acs in Desulfovibrio vulgaris Hildenborough

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate 208482 DVU2969 acetoacetyl-CoA synthase

Query= SwissProt::P27550
         (652 letters)



>MicrobesOnline__882:208482
          Length = 661

 Score =  746 bits (1927), Expect = 0.0
 Identities = 367/623 (58%), Positives = 462/623 (74%), Gaps = 8/623 (1%)

Query: 25  EAMYQQSINVPDTFWGEQG-KILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLD 83
           EA+ +++   P+ FWGE+  +++DW KP+  V +         I+W++ G LN+A NCLD
Sbjct: 35  EALVRRAAEDPEGFWGERAAQLIDWFKPWDTVLDADM--NEPRIEWFKGGRLNVAHNCLD 92

Query: 84  RHLQENG-DRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMV 142
           RH+  N  ++ AIIW+G+     + ++Y+ L+ +V RFA  L ++G+ KGD V++YMPM+
Sbjct: 93  RHVAGNRRNKAAIIWQGEPEEDVRVLTYQMLYDEVRRFAAVLRKMGVHKGDRVSLYMPMI 152

Query: 143 PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNV 202
           PE AVAMLACARIGAVHS++F GFS  ++  RI D  +++V+T+D  +RAGR IPLK NV
Sbjct: 153 PELAVAMLACARIGAVHSIVFAGFSAVSLQNRIHDCEAKVVVTADAVLRAGRRIPLKVNV 212

Query: 203 DDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQAS--DQHQAEEMNAEDPLF 260
           D+A++     SVE VVV+ R   ++  +EGRDLWWH+++   +       EEM+AED LF
Sbjct: 213 DEAVRQ--CPSVEKVVVVNRGSLEVTMEEGRDLWWHEVMADRTLDVDRPCEEMDAEDMLF 270

Query: 261 ILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP 320
           ILYTSGSTGKPKGV+HTTGGYL YAA T ++VFD    D+YWCTAD+GW+TGHSY++YGP
Sbjct: 271 ILYTSGSTGKPKGVVHTTGGYLTYAAHTTQWVFDVQDDDVYWCTADIGWITGHSYIVYGP 330

Query: 321 LACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSL 380
           LA GAT+LMFEGVP+WP+P R  ++V+K +VNI YTAPT +RALM EG    E  D SSL
Sbjct: 331 LALGATSLMFEGVPSWPSPDRFWRIVEKFRVNIFYTAPTVVRALMREGTDWTERHDLSSL 390

Query: 381 RILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRP 440
           R+LGSVGEPINPEAW WY   IG  + P+VDTWWQTETGG MI+ LP AT LK GSAT+P
Sbjct: 391 RVLGSVGEPINPEAWMWYHTHIGKGRLPIVDTWWQTETGGIMISGLPYATTLKPGSATQP 450

Query: 441 FFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGD 500
             GV  A+V  +G+P      G LVI   WPG  R +FG  ER+  TYF  F  MY SGD
Sbjct: 451 LPGVDAAIVRPDGSPAGPNEGGHLVIRKPWPGMLRGIFGSPERYRSTYFERFPGMYESGD 510

Query: 501 GARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIY 560
           GAR D DGY+WI GR+DDV+NVSGHR+GTAE+ESALVAHP +AEAAVVG+PH +KG+AIY
Sbjct: 511 GARTDTDGYFWIMGRLDDVINVSGHRMGTAEVESALVAHPSVAEAAVVGMPHAVKGEAIY 570

Query: 561 AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAA 620
           AYVTL    E + EL AE+R WVRKEIGP+ATPDVL + + LPKTRSGKIMRRILRKIAA
Sbjct: 571 AYVTLGADAEETEELRAELRAWVRKEIGPIATPDVLQFAEGLPKTRSGKIMRRILRKIAA 630

Query: 621 GDTSNLGDTSTLADPGVVEKLLE 643
           G TS  GDTSTLADPGVV  L+E
Sbjct: 631 GATSEFGDTSTLADPGVVSDLIE 653


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1389
Number of extensions: 64
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 661
Length adjustment: 38
Effective length of query: 614
Effective length of database: 623
Effective search space:   382522
Effective search space used:   382522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate 208482 DVU2969 (acetoacetyl-CoA synthase)
to HMM TIGR02188 (acs: acetate--CoA ligase (EC 6.2.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.18059.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.18059.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.