Align L-lactate dehydrogenase complex protein LldG (characterized, see rationale)
to candidate 208546 DVU3032 conserved hypothetical protein
Query= uniprot:Q8EGS6 (189 letters) >MicrobesOnline__882:208546 Length = 209 Score = 53.9 bits (128), Expect = 2e-12 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 8/105 (7%) Query: 91 LRDIDYAVIPGDVGVAENGAIWVNNKNLGHRVTPFICENLILALPIHKIVPNMHQAAKEV 150 L ID +G+AE G V++ + R+ I E + LP KIV + A E Sbjct: 105 LAGIDIGFTHVTMGIAETGTCVVSSNSEELRLASMISEFHVAVLPKSKIVATSYDA--EA 162 Query: 151 TLDA------GEFGVFIAGPSKTADIEQALVVGAHGACSLNVYLV 189 TL+ + FI+GPS+TADIE+ L +G HG L++ LV Sbjct: 163 TLNELMGTGKPHYTAFISGPSRTADIERVLSLGVHGPLELHLILV 207 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 83 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 189 Length of database: 209 Length adjustment: 20 Effective length of query: 169 Effective length of database: 189 Effective search space: 31941 Effective search space used: 31941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory