GapMind for catabolism of small carbon sources

 

Alignments for a candidate for lutC in Desulfovibrio vulgaris Hildenborough

Align Protein containing DUF162 (characterized, see rationale)
to candidate 208546 DVU3032 conserved hypothetical protein

Query= uniprot:E4PLR7
         (223 letters)



>MicrobesOnline__882:208546
          Length = 209

 Score = 69.7 bits (169), Expect = 4e-17
 Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (1%)

Query: 123 VEASLTGTLGGIAATGTLVLWPDCHEPRLMSLVPPVHIALLKASEIHDNLYDMMVAQD-- 180
           ++   T    GIA TGT V+  +  E RL S++   H+A+L  S+I    YD     +  
Sbjct: 108 IDIGFTHVTMGIAETGTCVVSSNSEELRLASMISEFHVAVLPKSKIVATSYDAEATLNEL 167

Query: 181 WAAGLPTNVLLVSGPSKTADIEQVLAYGAHGPRELIVLVLE 221
              G P     +SGPS+TADIE+VL+ G HGP EL ++++E
Sbjct: 168 MGTGKPHYTAFISGPSRTADIERVLSLGVHGPLELHLILVE 208


Lambda     K      H
   0.317    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 98
Number of extensions: 4
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 223
Length of database: 209
Length adjustment: 22
Effective length of query: 201
Effective length of database: 187
Effective search space:    37587
Effective search space used:    37587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory