Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate 207786 DVU2299 glycine/betaine/L-proline ABC transporter, ATP binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >MicrobesOnline__882:207786 Length = 397 Score = 168 bits (425), Expect = 3e-46 Identities = 92/240 (38%), Positives = 145/240 (60%), Gaps = 11/240 (4%) Query: 31 SHEVLKGID---LDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDGVEVGHVA 87 SH V G+D DV++GE V+ +G SG GKSTL+R + L + T+G+V +DG +V + Sbjct: 38 SHAV--GVDRASFDVEEGEIVVVMGLSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMP 95 Query: 88 P------AKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLEP 141 +R MVFQ++AL+PH TV N GL+ GVP+AE E + + + L Sbjct: 96 VDELRRLRQRSFGMVFQNFALFPHRTVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAE 155 Query: 142 YLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLKA 201 + A RPA+LSGG +QRV + RA+ +P + L DE S LD +R + + E+ RL L+ Sbjct: 156 WAASRPAQLSGGMQQRVGLARALSLDPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQK 215 Query: 202 TMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQMNFIEAA 261 T+++++HD EA+ L D+IV++ G + Q+G+P ++ PA+ +VA F+G + + A Sbjct: 216 TIVFISHDLDEALKLGDRIVLMRDGAVVQIGTPEDILTNPADDYVARFVGEADVTKVLTA 275 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 397 Length adjustment: 30 Effective length of query: 322 Effective length of database: 367 Effective search space: 118174 Effective search space used: 118174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory