Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate 208684 DVU3164 ABC transporter, permease protein
Query= TCDB::Q8RJU8 (307 letters) >MicrobesOnline__882:208684 Length = 277 Score = 132 bits (333), Expect = 7e-36 Identities = 80/258 (31%), Positives = 141/258 (54%), Gaps = 5/258 (1%) Query: 50 AFMVVLPLLWAVMTSFKDDASIFGSPWSLPDKLHFDNWSRAWTEAHMGDYFLNTVLVVGG 109 A M LPLL+A+ T+F A + + ++L L +N+ AW A YF+NTVL+V Sbjct: 25 AIMWALPLLYAIWTAFHPSA--YSTRFTLNAPLTLENFVTAWHAAPFALYFVNTVLLVTM 82 Query: 110 SLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMGLLNTLH 169 L LVL ++AAY A++DF G ++ L + + + +V + + ++G+L++ Sbjct: 83 VLAAQLVLCTLAAYAFAKYDFRGKNIMFALVLMQLMIMPDVLVVENYRTMASIGVLDSTL 142 Query: 170 GLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLISVG 229 + L Y+A + F +F L F+++P + EAA V+GAS + +++ +P+ KP ++ Sbjct: 143 AIGLPYMASA--FGIFLLRQTFKSIPKELDEAAAVEGASTLQILWKVYVPLGKPVYLAYA 200 Query: 230 IFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPVLAA 289 + + WN ++ P ++ + R LT GL Q+ S DW+ + A +M P+L A Sbjct: 201 LVSISYHWNNFLWPLIVTNTTNSRPLTVGL-QVFSSTEQGVDWAIITAATLMTSGPLLVA 259 Query: 290 YIIFQRQVVQGLTAGALK 307 +++FQRQ VQ +K Sbjct: 260 FLLFQRQFVQSFMRAGIK 277 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 277 Length adjustment: 26 Effective length of query: 281 Effective length of database: 251 Effective search space: 70531 Effective search space used: 70531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory