Align Xylose/arabinose import permease protein XacH (characterized, see rationale)
to candidate 208683 DVU3163 ABC transporter, permease protein
Query= uniprot:D4GP36 (317 letters) >MicrobesOnline__882:208683 Length = 293 Score = 127 bits (319), Expect = 3e-34 Identities = 75/249 (30%), Positives = 125/249 (50%), Gaps = 2/249 (0%) Query: 66 EGLGTPDYSTLDLEMYAQALSSDAFIAAAQNNLVLLVGFTTICLVLGLFLAILLDHGIRF 125 +G G + + LE Y + F A NNL+ G + + L + +A +++ G+ Sbjct: 42 DGKGGAPATFVGLEHYMYLFEDEVFRKALVNNLLFASGTIPLSIGLAMLMAFMVNAGLAG 101 Query: 126 SEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILNLVVTTLGFNPVDWLGNPSIALGAVI 185 + Y +P L + A +WL+ F E G+L V LGF+ V+WLGN S AL VI Sbjct: 102 QSVLRLCYFVPTVLPMIAVANIWLFFFTPEYGLLEQVRGALGFSGVNWLGNESTALPCVI 161 Query: 186 LALIWQFSGYTMVVYLAGLQSIPDDQFEAARVDGASITRTYLRIIVPQLKEASVSAAVVL 245 +W+ +G+ M+ YLA LQ I EAA ++GAS Y R+++P L ++ V Sbjct: 162 AVAVWKDAGFFMIFYLAALQQISPSLGEAAMLEGASRLYFYRRVVIPLLMPTTLFVLVNA 221 Query: 246 MVFALKAFTFLYALVGRYRPPNGTDILATLMVRRAFKFGEWAYSAAIATMLL-IMALGVI 304 + A + L+ L + P N + +L + +FK+ + Y AA+ +LL + L I Sbjct: 222 TINAFRMVDHLFVLT-QGGPNNASSLLLYYIYEVSFKYWDTGYGAALTMVLLAFLGLASI 280 Query: 305 GPYLYYQYK 313 G + +++ K Sbjct: 281 GQFGFFERK 289 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 293 Length adjustment: 27 Effective length of query: 290 Effective length of database: 266 Effective search space: 77140 Effective search space used: 77140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory