Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate 209027 DVU0098 polyamine ABC transporter, ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >MicrobesOnline__882:209027 Length = 368 Score = 231 bits (589), Expect = 2e-65 Identities = 126/278 (45%), Positives = 183/278 (65%), Gaps = 11/278 (3%) Query: 20 DIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQD 79 D A++ I L+I +GEFL L+GPSGCGK+T LR+++G E G + L+ + ++ + Sbjct: 19 DTCALDNIDLEIRNGEFLTLLGPSGCGKTTILRLISGFEKPDAGVITLKGQRMDDAPPEA 78 Query: 80 RDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGISDLLDRKPGQ 139 R + VFQ+YAL+PH SVR N+ FGL P DEI +RV + M+ + DR+P Q Sbjct: 79 RQVNTVFQNYALFPHMSVRENVGFGLRMQRR-PKDEIARRVHDALRMVHLEAHADRRPRQ 137 Query: 140 LSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTHD 199 LSGGQQQRVA+ RA+V +P V L+DEP S LD KLR +M+ E++ LQ +LG+T V+VTHD Sbjct: 138 LSGGQQQRVAIARAVVNNPLVLLLDEPFSALDYKLRKQMQLEIKHLQRQLGITFVFVTHD 197 Query: 200 QTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLSGDTFRG 259 Q EA M DRV V++DG+++Q+G+P + Y P NL+VA F+GE +N+ + ++ + G Sbjct: 198 QEEAFAMSDRVVVMNDGKIEQIGSPQEIYEEPANLYVARFVGE--INILNAVIAAN--HG 253 Query: 260 DG-FDYPLSGAT---RDQLGGASG--LTLGIRPEDVTV 291 DG +D + G T R Q A G + + +RPED+ V Sbjct: 254 DGLYDAVIEGVTFPIRSQRTFAPGDKVNVLLRPEDLRV 291 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 368 Length adjustment: 30 Effective length of query: 353 Effective length of database: 338 Effective search space: 119314 Effective search space used: 119314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory