Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate 209027 DVU0098 polyamine ABC transporter, ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >MicrobesOnline__882:209027 Length = 368 Score = 120 bits (302), Expect = 3e-32 Identities = 73/248 (29%), Positives = 146/248 (58%), Gaps = 13/248 (5%) Query: 3 DLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLV 62 +++E+R V K+F ALD + +EI GE + LLG +G GK+T++++ISG+ KPD G + Sbjct: 6 NIIELRGVTKNFEDTCALDNIDLEIRNGEFLTLLGPSGCGKTTILRLISGFEKPDAGVIT 65 Query: 63 FEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESK 122 +G++ + ++P +AR + T++Q+ AL P + + N+ + + ++ E ++ Sbjct: 66 LKGQR-MDDAPPEARQ--VNTVFQNYALFPHMSVRENVGFG------LRMQRRPKDEIAR 116 Query: 123 KLLDSLQI--RIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSV-VEARK 179 ++ D+L++ + + LSGGQ+Q VA+ARAV + ++L+DEP +AL + + Sbjct: 117 RVHDALRMVHLEAHADRRPRQLSGGQQQRVAIARAVVNNPLVLLLDEPFSALDYKLRKQM 176 Query: 180 VLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEVMTS 239 LE+ ++ G+ + +TH+ + + ++DR+ V++ GKI +E EE + + Sbjct: 177 QLEIKHLQRQLGITFVFVTHDQEEAFAMSDRVVVMNDGKIEQIGSPQEI-YEEPANLYVA 235 Query: 240 FALGKVNL 247 +G++N+ Sbjct: 236 RFVGEINI 243 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 368 Length adjustment: 27 Effective length of query: 224 Effective length of database: 341 Effective search space: 76384 Effective search space used: 76384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory