GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Desulfovibrio vulgaris Hildenborough

Align pyrroline-5-carboxylate reductase (EC 1.5.1.2) (characterized)
to candidate 207819 DVU2332 pyrroline-5-carboxylate reductase

Query= metacyc::MONOMER-7803
         (277 letters)



>lcl|MicrobesOnline__882:207819 DVU2332 pyrroline-5-carboxylate
           reductase
          Length = 265

 Score =  157 bits (397), Expect = 2e-43
 Identities = 97/266 (36%), Positives = 150/266 (56%), Gaps = 8/266 (3%)

Query: 14  LGFVGAGNLAESIARGVAASGVLPASAVRTAPHRRPERAAAFASLGATILASNAQVVDDS 73
           LG +G GN+  +I RG+  SG      V   P     + AA A  G   +A  A  V  S
Sbjct: 5   LGCIGCGNMGSAILRGL--SGREGLRLVGCDP--TGAKLAALADAGVEGVADIAAAVRAS 60

Query: 74  DVIVISVKPQIVKQVLVELKPLLSEEKLLVSIAAGIKMKDLQDWSGQR-RIIRVMPNTPS 132
           D+++++VKP  V  VL    P L   K++VSIA+G+ +  L++ SG R  ++RVMPNTP+
Sbjct: 61  DIVLVAVKPGQVGAVLGAAMPELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPA 120

Query: 133 AVGQAASVMCLGETATENDENR--VKSLFSAIGKVWTAEEKYFDAVTGLSGSGPAYIFLA 190
            VG     +C  E AT ++  R  VK LF A+G+V    E+ F+A T + G GPAY+F  
Sbjct: 121 MVGAGVFALCF-EDATLDEVRRTLVKELFEALGRVLVLPEEKFNAFTAVVGCGPAYVFHF 179

Query: 191 IEAMADGGVAAGLPRDLALGLAAQTVLGAATMVSETGKHPGQLKDQVTSPAGTTIAGVHE 250
           +EA+ +  V  G PR  A  +      G+  + + +G H   L++ V SPAG TIA +++
Sbjct: 180 MEAVVEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAMNQ 239

Query: 251 LEKGSFRGTLINAVVAATTRCRELSK 276
            ++ + RG +I+A++AA  R +E+ +
Sbjct: 240 FDRDAVRGRIIDAILAAYRRGQEMER 265


Lambda     K      H
   0.315    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 187
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 277
Length of database: 265
Length adjustment: 25
Effective length of query: 252
Effective length of database: 240
Effective search space:    60480
Effective search space used:    60480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate 207819 DVU2332 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.9761.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
    1.1e-76  243.9   0.8    1.2e-76  243.8   0.8    1.0  1  lcl|MicrobesOnline__882:207819  DVU2332 pyrroline-5-carboxylate 


Domain annotation for each sequence (and alignments):
>> lcl|MicrobesOnline__882:207819  DVU2332 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  243.8   0.8   1.2e-76   1.2e-76       2     263 .]       6     263 ..       5     263 .. 0.94

  Alignments for each domain:
  == domain 1  score: 243.8 bits;  conditional E-value: 1.2e-76
                       TIGR00112   2 aiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPqdleevlaelk 80 
                                     + iG+Gnmg+a+l+gl+ ++     +++ +++  +klaala ++gve ++d ++av+++d+vl+avKP ++ +vl    
  lcl|MicrobesOnline__882:207819   6 GCIGCGNMGSAILRGLSGREG---LRLVGCDPTGAKLAALA-DAGVEGVADIAAAVRASDIVLVAVKPGQVGAVLGAAM 80 
                                     78*************998744...45666776677777666.56788889999**********************9766 PP

                       TIGR00112  81 seektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevsee.qkelveellkavGkvveve 158
                                       e   +k+++Si+ Gv++  l+++ +++++vvRvmPNt+a+vgagv a++ ++++ +e +++lv+el++a+G v+ ++
  lcl|MicrobesOnline__882:207819  81 P-ELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPAMVGAGVFALCFEDATLDEvRRTLVKELFEALGRVLVLP 158
                                     6.6679***********************************************9999999******************* PP

                       TIGR00112 159 eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkdkVtsPgGtTiagl 237
                                     e++++a+ta++G+gPA+vf+++ea+++a+v lG+pr+ea++++ ++++G++kl + sg h +lL+++V+sP+G Tia++
  lcl|MicrobesOnline__882:207819 159 EEKFNAFTAVVGCGPAYVFHFMEAVVEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAM 237
                                     ******************************************************************************* PP

                       TIGR00112 238 avLeekgvrsavieaveaavkrseeL 263
                                     + + +++vr+ +i+a+ aa++r +e+
  lcl|MicrobesOnline__882:207819 238 NQFDRDAVRGRIIDAILAAYRRGQEM 263
                                     **********************9986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (265 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.26
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory