Align Putative ABC transporter arginine-binding protein 2 (characterized)
to candidate 206677 DVU1238 amino acid ABC transporter, periplasmic amino acid-binding protein
Query= SwissProt::P30859 (243 letters) >MicrobesOnline__882:206677 Length = 246 Score = 128 bits (321), Expect = 1e-34 Identities = 88/249 (35%), Positives = 130/249 (52%), Gaps = 16/249 (6%) Query: 1 MKKVL--IAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEI 58 ++KVL +AAL+ ++ A A T+ FA +A++PP E +DAN QIVG VD A+ KE Sbjct: 2 LQKVLLTVAALLLSTNV-AFAERTVVFAHDATWPPMEFVDANKQIVGLAVDYVDAIAKEA 60 Query: 59 DATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYD-NSALFVGQQGK 117 N A+D + L + +A+ + + IT ER+K + FT PY+D AL V + + Sbjct: 61 GFKVVHKNVAWDGIFAGLAAGKYDAIASSVTITEERKKAMDFTMPYFDVKQALVVPKTTE 120 Query: 118 YTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAV 177 +++ +KGK +G Q TT F + + +T YD A DL NGRIDGV D V Sbjct: 121 AKTLEDMKGKTLGAQISTTGH-FAIKRTAGVTAKSYDEIGLAMEDLFNGRIDGVVCDDPV 179 Query: 178 VTEWLKDNP------KLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDG 231 + K+A + D + +Y+ GIAV+QGN EL +N +E VK G Sbjct: 180 AANYALQQEEYAKKLKIAFIVD-TPESEYY----GIAVKQGNKELVDLINKGIEAVKAKG 234 Query: 232 TYETIYNKW 240 + KW Sbjct: 235 IDAQLRAKW 243 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 246 Length adjustment: 24 Effective length of query: 219 Effective length of database: 222 Effective search space: 48618 Effective search space used: 48618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory