Align L-Arginine ABC transporter, permease component 1 (characterized)
to candidate 206098 DVU0674 ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo5_N2C3_1:AO356_18710 (232 letters) >MicrobesOnline__882:206098 Length = 271 Score = 123 bits (308), Expect = 4e-33 Identities = 73/210 (34%), Positives = 117/210 (55%), Gaps = 12/210 (5%) Query: 14 LYFSGLLTTLKLLALSLFFGLLAALPLGLMRVSKQPIVNMTAWLYTYVIRGTPMLVQLFL 73 L GL TL++ A SL LL A +R+S + A LY +R TP+LVQLF+ Sbjct: 68 LLLQGLGVTLQVAAGSLVLALLLAAVAVALRLSCLRTGRLVARLYVESVRNTPLLVQLFV 127 Query: 74 IYYGLAQ-FAIVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRATPNGEIEAAK 132 Y+ +A F + R + A +A + AY AEI+ + A P G+ EA++ Sbjct: 128 TYFAIAPVFGLGRMA-----------SAVMALGVFEGAYMAEILRAGIAAVPQGQWEASR 176 Query: 133 AMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAARTVNAQYY 192 ++GM Y +++LP ALRRALP + + + +++ +SLAS + + ++T A+T+ A+ + Sbjct: 177 SLGMDEPGTYVQVILPQALRRALPPLTGQAVSLVKDSSLASAIAIHELTMQAQTIIAETF 236 Query: 193 LPFEAYITAGAFYLCLTFILVRLFKLAERR 222 L FE ++ A YLC+T L + +L ERR Sbjct: 237 LTFEVWLLTAAIYLCVTLSLSAVARLLERR 266 Lambda K H 0.330 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 271 Length adjustment: 24 Effective length of query: 208 Effective length of database: 247 Effective search space: 51376 Effective search space used: 51376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory