GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aruH in Desulfovibrio vulgaris Hildenborough

Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate 208745 DVU3223 aspartate aminotransferase

Query= BRENDA::Q9HUI9
         (393 letters)



>lcl|MicrobesOnline__882:208745 DVU3223 aspartate aminotransferase
          Length = 390

 Score =  207 bits (526), Expect = 5e-58
 Identities = 138/391 (35%), Positives = 202/391 (51%), Gaps = 14/391 (3%)

Query: 1   MRYSDFTQRIAGDGAAAWDIHYRALARVEQGEEILLLSVGDPDFDTPAPIVQAAIDSLLA 60
           M  SD   RI      A  ++ +AL    +G +++ L+VG+PDF TPA I +AA  ++  
Sbjct: 1   MNISDRLTRIKPSATLA--VNAKALELKARGVKVVSLAVGEPDFGTPAHICEAAKRAIDE 58

Query: 61  GNTHYADVRGKRALRQRIAERHRRRSGQAVDAEQVVVLAGAQCALYAVVQCLLNPGDEVI 120
           G T Y  V G   LR+ +A    R  G    AE  +V  G + ALY + Q LLNPGDEV+
Sbjct: 59  GFTRYTPVPGIIELREAVAGYFGRCYGVEAPAEATIVTNGGKQALYNLFQALLNPGDEVL 118

Query: 121 VAEPMYVTYEAVFGACGARVVPVPVRSENGFRVQAEEVAALITPRTRAMALNSPHNPSGA 180
           V  P +V+Y A+        V VP  +E GF++   E+ A  TPRTR + LNSP NP+GA
Sbjct: 119 VPAPYWVSYPALVQLAEGVPVFVPSPAERGFKITPAELDAHRTPRTRVLLLNSPSNPTGA 178

Query: 181 SLPRATWEALAELCMAHDLWMISDEVYSELLFDGEHVSPASLPG----MADRTATLNSLS 236
              R   +AL +  + HD+++I+DE+Y  L++    + P S+ G      DR A +N L+
Sbjct: 179 CYTREEMDALMQWAVDHDIFVIADEIYDRLVYG--DMQPVSVSGWWQRFPDRVAVVNGLA 236

Query: 237 KSHAMTGWRVGWVVGPAALCAHLENLALCMLYGSPEFIQDAACTALEAPLPELEAMREAY 296
           K+ AMTGWRVG+V+    L   +  +            Q AA  AL  P   +E MR A+
Sbjct: 237 KTFAMTGWRVGYVLAHPDLVKAVAKIQGQSTSNICSIAQKAALAALTGPYDAVEEMRCAF 296

Query: 297 RRRRDLVIECLADSPGLRPLRPDGGMFVMVDI----RPTGLSAQAFADRLLDRHGVSVLA 352
            RRRDL  + ++    +   RPDG  ++  DI      +   + A   RLL+   V+++ 
Sbjct: 297 VRRRDLAYDIISGWKDVVCPRPDGAFYLFADIHRHYNASMPDSAAVCTRLLEEAQVALVP 356

Query: 353 GEAFGPSAAGHIRLGLVLGAEPLREACRRIA 383
           G AFG      IR    +  + L +A  R+A
Sbjct: 357 GSAFGDDKC--IRFSYAVADDVLEDALSRVA 385


Lambda     K      H
   0.322    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 432
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 390
Length adjustment: 31
Effective length of query: 362
Effective length of database: 359
Effective search space:   129958
Effective search space used:   129958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory