Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate 208745 DVU3223 aspartate aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >MicrobesOnline__882:208745 Length = 390 Score = 207 bits (526), Expect = 5e-58 Identities = 138/391 (35%), Positives = 202/391 (51%), Gaps = 14/391 (3%) Query: 1 MRYSDFTQRIAGDGAAAWDIHYRALARVEQGEEILLLSVGDPDFDTPAPIVQAAIDSLLA 60 M SD RI A ++ +AL +G +++ L+VG+PDF TPA I +AA ++ Sbjct: 1 MNISDRLTRIKPSATLA--VNAKALELKARGVKVVSLAVGEPDFGTPAHICEAAKRAIDE 58 Query: 61 GNTHYADVRGKRALRQRIAERHRRRSGQAVDAEQVVVLAGAQCALYAVVQCLLNPGDEVI 120 G T Y V G LR+ +A R G AE +V G + ALY + Q LLNPGDEV+ Sbjct: 59 GFTRYTPVPGIIELREAVAGYFGRCYGVEAPAEATIVTNGGKQALYNLFQALLNPGDEVL 118 Query: 121 VAEPMYVTYEAVFGACGARVVPVPVRSENGFRVQAEEVAALITPRTRAMALNSPHNPSGA 180 V P +V+Y A+ V VP +E GF++ E+ A TPRTR + LNSP NP+GA Sbjct: 119 VPAPYWVSYPALVQLAEGVPVFVPSPAERGFKITPAELDAHRTPRTRVLLLNSPSNPTGA 178 Query: 181 SLPRATWEALAELCMAHDLWMISDEVYSELLFDGEHVSPASLPG----MADRTATLNSLS 236 R +AL + + HD+++I+DE+Y L++ + P S+ G DR A +N L+ Sbjct: 179 CYTREEMDALMQWAVDHDIFVIADEIYDRLVYG--DMQPVSVSGWWQRFPDRVAVVNGLA 236 Query: 237 KSHAMTGWRVGWVVGPAALCAHLENLALCMLYGSPEFIQDAACTALEAPLPELEAMREAY 296 K+ AMTGWRVG+V+ L + + Q AA AL P +E MR A+ Sbjct: 237 KTFAMTGWRVGYVLAHPDLVKAVAKIQGQSTSNICSIAQKAALAALTGPYDAVEEMRCAF 296 Query: 297 RRRRDLVIECLADSPGLRPLRPDGGMFVMVDI----RPTGLSAQAFADRLLDRHGVSVLA 352 RRRDL + ++ + RPDG ++ DI + + A RLL+ V+++ Sbjct: 297 VRRRDLAYDIISGWKDVVCPRPDGAFYLFADIHRHYNASMPDSAAVCTRLLEEAQVALVP 356 Query: 353 GEAFGPSAAGHIRLGLVLGAEPLREACRRIA 383 G AFG IR + + L +A R+A Sbjct: 357 GSAFGDDKC--IRFSYAVADDVLEDALSRVA 385 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 390 Length adjustment: 31 Effective length of query: 362 Effective length of database: 359 Effective search space: 129958 Effective search space used: 129958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory