Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate 208821 DVU3294 aldehyde dehydrogenase (NADP) family protein
Query= BRENDA::Q88RC0 (480 letters) >MicrobesOnline__882:208821 Length = 464 Score = 226 bits (576), Expect = 1e-63 Identities = 152/443 (34%), Positives = 224/443 (50%), Gaps = 10/443 (2%) Query: 27 TIKVTNPATGEVIGTVPKMGTAETRRAIEAADKAL--PAWRALTAKERSAKLRRWFELMI 84 +I V NP +G VP M AE A+E A PA R + A ER A L R LM Sbjct: 3 SITVRNPFDLSTVGEVPLMSEAEAFAALERAHALHGDPAHR-IPAHERLAILERLATLMR 61 Query: 85 ENQDDLARLMTTEQGKPLAEAKGEIAYAASFIEWFAEEAKRIYGDTIP-GHQP---DKRL 140 + + L R E GKP A++ E+ A + W A E ++ G +P G P + Sbjct: 62 THAEALVRDAVREGGKPWADSVVEVERAIDGVRWAARELAQLGGREVPMGLTPASAGRLA 121 Query: 141 IVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAG 200 +++P GV AI+ +N P +I +A PA AAGC +++KPAS TP S ++ L H AG Sbjct: 122 FTVREPRGVVLAISAFNHPVNLIVHQAVPAFAAGCPVLVKPASATPLSCRNVLRLMHEAG 181 Query: 201 IPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNA 260 +P +++ +A +L + V LSF GS+ +G L + A +LE GG A Sbjct: 182 VPEAWATMLPCAAA-TAEKLVADPRVAFLSFIGSSRVGWHLRSKLAPGAT-CALEHGGAA 239 Query: 261 PFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVYDAFAEKLAAAVAKLKIGN 320 P ++ ADLD A+ + + + GQ CV R++ FAE+LAAA A+L G+ Sbjct: 240 PVVLDASADLDAALPLLLKGGFYHAGQVCVSVQRVFAPHETARTFAERLAAAAAQLPTGD 299 Query: 321 GLEEGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAV 380 + T GPLID + V++V E +E+A + G VL GG + + PT++ D P+ + Sbjct: 300 PMRHDTAVGPLIDPREVSRVHEWVEEARAGGGTVLCGGAPLSETLYSPTVVYDPPQGCRL 359 Query: 381 AKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINT 440 A+ E FGP+ +F +D E IA +ND F + +ARD+ A L V +N Sbjct: 360 ARNEVFGPVVAVFSTRDRDEAIARANDVPFIFQAAVFARDVDVALDTARRLNATGVMVND 419 Query: 441 GLISN-EVAPFGGIKASGLGREG 462 + PFGG SG+G G Sbjct: 420 HTAFRVDWMPFGGRGESGMGTGG 442 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 464 Length adjustment: 33 Effective length of query: 447 Effective length of database: 431 Effective search space: 192657 Effective search space used: 192657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory