GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patD in Desulfovibrio vulgaris Hildenborough

Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19); betaine-aldehyde dehydrogenase (EC 1.2.1.8) (characterized)
to candidate 208845 DVU3319 proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase

Query= BRENDA::Q9S795
         (501 letters)



>lcl|MicrobesOnline__882:208845 DVU3319 proline
           dehydrogenase/delta-1-pyrroline-5-carboxylate
           dehydrogenase
          Length = 1006

 Score =  234 bits (596), Expect = 1e-65
 Identities = 161/494 (32%), Positives = 244/494 (49%), Gaps = 24/494 (4%)

Query: 7   TRQLFIDGEWREPILKKRIPIVNPATE-EVIGDIPAATTEDVDVAVNAARRALSRNKGKD 65
           T  L+I G  R+      IP  NPA   EV+  I  A   ++D A+ AA++A        
Sbjct: 511 TVPLYIGG--RDVTTADLIPTTNPAKPAEVVASICQAGRPEIDDAIAAAKKA-----ALT 563

Query: 66  WAKAPGAVRAKYLRAIAAKVNERKTDLAKLEALDCGKPLDEAVWDMDDVAGCFEFYADLA 125
           W     A RA YLR  A    +R  +L+  + ++ GK  D+A  D+ +     E+YA   
Sbjct: 564 WRDTSPADRAAYLRRAADICRKRIWELSAWQVVEVGKQWDQAYHDVTEGIDFLEYYAREM 623

Query: 126 EGLDAKQKAPVSLPMESFKSYVLKQPLGVVGLITPWNYPLLMAVWKVAPSLAAGCTAILK 185
             L A ++   + P E   +++  QP G+  +I PWN+P  +A+   + ++  G   I K
Sbjct: 624 LRLGAPRRMGRA-PGEH--NHLFYQPKGIAAVIAPWNFPFAIAIGMASAAIVTGNPVIFK 680

Query: 186 PSELASVTCLELADICREVGLPPGVLNVLTGFGSEAGAPLASHPGVDKIAFTGSFATGSK 245
           PS ++S     LA++ RE GLP GV N   G  S  G  L  HP +  I FTGS   G +
Sbjct: 681 PSSISSRIGYNLAEVFREAGLPEGVFNYCPGRSSIMGDYLVEHPDISLICFTGSMEVGLR 740

Query: 246 VMTAAAQL------VKPVSMELGGKSPLIVFDDVDLDKAAEWALFGCFWTNGQICSATSR 299
           +   AA++       K V  E+GGK+  I+ DD DLD+A    L+  F   GQ CSA SR
Sbjct: 741 IQEKAAKVQPGQRQCKRVIAEMGGKNATIIDDDADLDEAVLQVLYSAFGFQGQKCSACSR 800

Query: 300 LLVHESIASEFIEKLVKWSKNIKISDPMEEGCRLGPVVSKGQYEKILKFISTAKSEGATI 359
           ++V ++I   FIE+LVK + +I I    +    +GPV      + +  +I  A+ EG  +
Sbjct: 801 VIVLDAIYDRFIERLVKAASSIHIGPSEDPSNYMGPVADATLQKNVSDYIRIAEEEGRVL 860

Query: 360 LHGGSRPEHLEKGFFIEPTIITDVTTSMQIWREEVFGPVLCVKTFASEDEAIELANDSHY 419
           L    R +   +G ++  TI+ D+    +I +EE+FGPVL V   A+ DEA+ +AN + +
Sbjct: 861 L---KRTDLPAEGCYVPLTIVGDIRPEHRIAQEEIFGPVLAVMRAATFDEALSIANGTRF 917

Query: 420 GLGAAVISNDTERCDRISEAFEAGIVWIN--CSQPCFTQAPWGGVKRSGFGRELGEWGLD 477
            L  AV S   E  D+    F  G +++N   +     + P+GG   SG G + G  G D
Sbjct: 918 ALTGAVFSRSPEHLDKARREFRVGNLYLNKGSTGALVERQPFGGFAMSGVGSKTG--GPD 975

Query: 478 NYLSVKQVTLYTSN 491
             L      + T N
Sbjct: 976 YLLQFMDPRVVTEN 989


Lambda     K      H
   0.318    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1136
Number of extensions: 43
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 501
Length of database: 1006
Length adjustment: 39
Effective length of query: 462
Effective length of database: 967
Effective search space:   446754
Effective search space used:   446754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory