Align N1-aminopropylagmatine ureohydrolase (EC 3.5.3.24) (characterized)
to candidate 209357 DVU0421 agmatinase, putative
Query= BRENDA::Q5JI38 (288 letters) >MicrobesOnline__882:209357 Length = 290 Score = 139 bits (351), Expect = 6e-38 Identities = 95/289 (32%), Positives = 145/289 (50%), Gaps = 18/289 (6%) Query: 10 LKLEFPLVEPEKARFILLGVPFDGTTSYKAGARFGPTLIRQATLNLESYILDYDLDIAEL 69 L E + PE+ARF ++ PF+ + SY G GP I A+ LE + D + Sbjct: 10 LASELDDIAPEEARFHVIPAPFEASVSYGGGTGAGPDAILDASDQLELW------DGLSI 63 Query: 70 PIAD---IGDIAVVAGDPRKTADRVRETLEELKKANPKAIPILLGGEHSQTLGAVEALKP 126 P A GD DR+ + A P+LLGGEH+ T GA+ AL+ Sbjct: 64 PAAQGIHTHPPVDCTGDAEAVLDRISRATRSVLDAG--GTPVLLGGEHTVTYGALAALRE 121 Query: 127 A----SYVVFDAHLDLRNSYEDNPYNHACVARR-ISELGVKEAIFGIRSGTKEEVDFARE 181 V FDAH DLR+SYE + ++HA V RR +S+LG+ +G+R+ EEV F RE Sbjct: 122 RFGRFGVVQFDAHADLRDSYEGSRWSHASVMRRAVSDLGLPLVQYGVRALCTEEVAFRRE 181 Query: 182 RDIPWVHARDYSFDAFV--DLVEALPEPVYLSIDIDVFDLSMVPSTGTPEAGGLRFWEVV 239 + A + L + PE VY++ D+D D S++P+TGTP GGL +++ + Sbjct: 182 AGVTHWDAAQLARSGVPARPLPDDFPESVYVTFDVDGLDPSIMPATGTPVPGGLGWYDAL 241 Query: 240 EAIEWLVEKKEIAGFDIMEVAGEKLGDPTALTAAKLLFYSIGAMAKFGR 288 +E V + + GFD++E+A AA+L++ +G + + R Sbjct: 242 RLVERSVSGRRVLGFDVVELAPIAGWHAADFAAARLVYDIMGIIQRMAR 290 Lambda K H 0.319 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 290 Length adjustment: 26 Effective length of query: 262 Effective length of database: 264 Effective search space: 69168 Effective search space used: 69168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 209357 DVU0421 (agmatinase, putative)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.22257.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-68 214.9 0.0 1.1e-67 214.6 0.0 1.1 1 lcl|MicrobesOnline__882:209357 DVU0421 agmatinase, putative Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209357 DVU0421 agmatinase, putative # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 214.6 0.0 1.1e-67 1.1e-67 3 274 .. 9 283 .. 7 284 .. 0.90 Alignments for each domain: == domain 1 score: 214.6 bits; conditional E-value: 1.1e-67 TIGR01230 3 fleseae...yeeAevvivgiPydattsyrpGsrhgpeaireastnLeayseeldrdlallkvvDa.gdlplaaGdare 77 fl+se + eeA +++ P++a++sy G+ gp+ai++as++Le + + ++ + + +++ +Gda++ lcl|MicrobesOnline__882:209357 9 FLASELDdiaPEEARFHVIPAPFEASVSYGGGTGAGPDAILDASDQLELWDGL---SIPAAQGIHThPPVDC-TGDAEA 83 5666655444699***********************************98853...2333333333034555.9***** PP TIGR01230 78 mvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvmrr.vlelgln 155 ++++i ++++l++g +v +GGeH++t++ + A +++f+ + vvqfDAH+Dlrd +eg++ sha+vmrr v +lgl+ lcl|MicrobesOnline__882:209357 84 VLDRISRATRSVLDAGGTPVLLGGEHTVTYGALAALRERFGRFGVVQFDAHADLRDSYEGSRWSHASVMRRaVSDLGLP 162 *********************************************************************99456999** PP TIGR01230 156 vlqigiRsgikeeadlarennikvlk.relede..iaevlakvldkpvyvtiDiDvlDPafaPGvgtpepgGltskell 231 +q+g+R+ + ee + re ++ + +l+ + a+ l+ ++ + vyvt+D+D+lDP+ +P +gtp+pgGl+++++l lcl|MicrobesOnline__882:209357 163 LVQYGVRALCTEEVAFRREAGVTHWDaAQLARSgvPARPLPDDFPESVYVTFDVDGLDPSIMPATGTPVPGGLGWYDAL 241 *********************97777677776666789999************************************** PP TIGR01230 232 klfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 +l ++ + +v G+DvvE+aP + + ++++aa+l++++++ lcl|MicrobesOnline__882:209357 242 RLVERSVSGRRVLGFDVVELAP-IAGWHAADFAAARLVYDIMG 283 **********************.788999***********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.00 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory