Align ATPase (characterized, see rationale)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >MicrobesOnline__882:206675 Length = 247 Score = 274 bits (700), Expect = 1e-78 Identities = 143/248 (57%), Positives = 186/248 (75%), Gaps = 1/248 (0%) Query: 14 IASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALES 73 + +A E +I V K++G + AL VSL VQ GE VV++GPSGSGKST LR++N LE+ Sbjct: 1 MTAANEPIISIRNVWKFFG-ELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLEN 59 Query: 74 HQRGEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQ 133 +G I ++G + + DI IRQ++GMVFQ FNLFPH TVLQNL +AP+++R+ P + Sbjct: 60 VDKGSIIVDGKDIRAEDSDINVIRQDLGMVFQSFNLFPHKTVLQNLTMAPMRLRKVPRDE 119 Query: 134 AEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMV 193 AE+ A LL++V I+++A+ YP LSGGQQQRVAIARALAM P+I+LFDEPTSALDPEM+ Sbjct: 120 AESRALDLLKKVGISDKANVYPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMI 179 Query: 194 REVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRA 253 EVLDVM LA EGMTM+ THE+GFAREVADR++ M GQI+E+ P FF AP+ R Sbjct: 180 GEVLDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFFEAPEHPRL 239 Query: 254 KQFLAQIL 261 ++FL QIL Sbjct: 240 QKFLQQIL 247 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 247 Length adjustment: 24 Effective length of query: 237 Effective length of database: 223 Effective search space: 52851 Effective search space used: 52851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory