Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized)
to candidate 207827 DVU2340 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo3_N2E3:AO353_16280 (223 letters) >MicrobesOnline__882:207827 Length = 230 Score = 134 bits (338), Expect = 1e-36 Identities = 79/210 (37%), Positives = 111/210 (52%), Gaps = 7/210 (3%) Query: 14 GMWNGMVMTLQLTVLGVVGGIILGTLLALMRLSHSKLLSNIAGAYVNYFRSIPLLLVITW 73 G GM M++ L + G+ G LG LMRLS + A YV R IPLL++I W Sbjct: 21 GPLGGMAMSILLAIGGIFGAFWLGLAFGLMRLSEKWWVRAPAIVYVEVIRGIPLLMLIFW 80 Query: 74 FYLAVPFVLRWITGEDTPIGAFTSCIVAFMMFEAAYFCEIVRAGVQSIPKGQMGAAKALG 133 FY P L G P S ++AF++F AY EIVRAGV ++P GQM AA+ G Sbjct: 81 FYFLAPIAL----GHTLPEAE--SALIAFIVFTGAYIAEIVRAGVLALPAGQMEAARGTG 134 Query: 134 MGYGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFL-NATRASGDIIGRA 192 + Q M +ILPQA R M P + Q + L +DTSL Y +G+ + AT+ + + Sbjct: 135 LSKTQAMLFVILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVSELTRTATQVNNRTLTAP 194 Query: 193 NEFLIIAGLVYFTISFAASRLVKRLQKRFA 222 E + L+YF I + + +RL+K+ A Sbjct: 195 TEIFLTIALMYFVICWVLTATSRRLEKQMA 224 Lambda K H 0.331 0.143 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 230 Length adjustment: 22 Effective length of query: 201 Effective length of database: 208 Effective search space: 41808 Effective search space used: 41808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory