Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate 207828 DVU2341 amino acid ABC transproter, permease protein, His/Glu/Gln/Arg/opine family
Query= TCDB::Q88NY3 (248 letters) >MicrobesOnline__882:207828 Length = 233 Score = 169 bits (428), Expect = 5e-47 Identities = 93/233 (39%), Positives = 145/233 (62%), Gaps = 12/233 (5%) Query: 1 MNYNWDWGVFFKSTGVGSETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRL 60 M Y +DW + V S LDW + G+ T ++ + ++A+LLG+L+ VMR R Sbjct: 1 MQYTFDWNL------VLSGERLDWIVQGVITTCQLSGLSLVLAMLLGTLIAVMRLSGVRP 54 Query: 61 VSGIATAYVELFRNVPLLVQLFIWYFLVPDLLPEGLQEW-FKQDLNPTTSALISVVICLG 119 + A+ E FRN PLLVQ+F WYF +LP+ + +W +KQ+ + VI L Sbjct: 55 FVWFSVAFTEFFRNTPLLVQIFFWYFGSDAVLPDAVNQWLYKQNFE-----FAAGVISLT 109 Query: 120 LFTAARVCEQVRTGIQALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNV 179 ++TAA + E++R+GI ++P+ Q A+RA G S Q + V+LPQA+RII+PPL S+ LN+ Sbjct: 110 VYTAAFIAEEIRSGIFSIPRTQLEASRACGLSFMQAMSYVVLPQAFRIIVPPLISQALNL 169 Query: 180 FKNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMGLMLLMRM 232 FKNSS+ IG+MEL +Q ++ + FEAFT++TLIY +++ + LL+ + Sbjct: 170 FKNSSLCMTIGVMELTYMARQIESYTFHGFEAFTVSTLIYLCISLMVSLLINL 222 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 233 Length adjustment: 23 Effective length of query: 225 Effective length of database: 210 Effective search space: 47250 Effective search space used: 47250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory