Align ATPase (characterized, see rationale)
to candidate 206179 DVU0753 amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >MicrobesOnline__882:206179 Length = 243 Score = 290 bits (742), Expect = 2e-83 Identities = 144/241 (59%), Positives = 185/241 (76%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI+ E V KWY + L ++L + +GEVVV+ GPSGSGKST +R +N LE+ Q+G I Sbjct: 1 MIHFEHVHKWYPSGLHVLNDINLDIAQGEVVVICGPSGSGKSTLIRCINRLEAIQKGNIV 60 Query: 81 IEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQ 140 ++G ++ R ++ +R EVG VFQQFNL+PH+TVL+N+ LAP VR P A+AE TA + Sbjct: 61 VDGIDINAPRTNLTLLRAEVGFVFQQFNLYPHMTVLENITLAPTLVRNIPRAEAERTAME 120 Query: 141 LLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVM 200 LLE+V I ++A YPGQLSGGQQQRVAIAR LAM+PRI+LFDEPTSALDPEM+ EVLDVM Sbjct: 121 LLEKVNIPDKAGAYPGQLSGGQQQRVAIARGLAMKPRIMLFDEPTSALDPEMINEVLDVM 180 Query: 201 RDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 R LA EGMTM+ THE+GFAREVADRV+ M G +VE+ PD FF PQ +R+++FL++I Sbjct: 181 RQLAREGMTMVCVTHEMGFAREVADRVIFMDQGILVEQNTPDAFFNNPQHERSREFLSKI 240 Query: 261 L 261 L Sbjct: 241 L 241 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 243 Length adjustment: 24 Effective length of query: 237 Effective length of database: 219 Effective search space: 51903 Effective search space used: 51903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory