Align ATPase (characterized, see rationale)
to candidate 209035 DVU0105 glutamine ABC transporter, ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >MicrobesOnline__882:209035 Length = 244 Score = 267 bits (682), Expect = 2e-76 Identities = 136/241 (56%), Positives = 180/241 (74%), Gaps = 1/241 (0%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI + K YG+ L G+ LTV+ GEVVV++GPSGSGKST LR +N LE G I Sbjct: 4 MIEIRNLHKSYGDH-HVLRGIDLTVRTGEVVVVIGPSGSGKSTALRCINRLEEITSGTII 62 Query: 81 IEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQ 140 ++G+ L + DI +R E GMVFQQFNLFPH++VL+N+ + PV+VRR +A+A Sbjct: 63 VDGYDLYDPKTDINHVRTEAGMVFQQFNLFPHMSVLENVTIGPVKVRRMARQEAQALGLA 122 Query: 141 LLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVM 200 LLE+V +A++A YP QLSGGQ+QRVAIAR+LAMQP++LLFDEPTSALDPE+V EVL+VM Sbjct: 123 LLEKVGLADKAHAYPDQLSGGQKQRVAIARSLAMQPKVLLFDEPTSALDPELVGEVLEVM 182 Query: 201 RDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 + LA EGMTM+V THE+GFAREVADRV+ + G+I EE PP+ F P++ R ++FL ++ Sbjct: 183 KQLAREGMTMVVVTHEMGFAREVADRVIFIDYGKIQEEGPPNELFADPKNPRLREFLGKV 242 Query: 261 L 261 + Sbjct: 243 I 243 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 244 Length adjustment: 24 Effective length of query: 237 Effective length of database: 220 Effective search space: 52140 Effective search space used: 52140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory