Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate 206399 DVU0967 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= TCDB::Q8YPM8 (308 letters) >MicrobesOnline__882:206399 Length = 337 Score = 137 bits (344), Expect = 5e-37 Identities = 83/243 (34%), Positives = 133/243 (54%), Gaps = 20/243 (8%) Query: 63 GETLIAYKPTDTYSLA----LWVGLINSLRIAFVGIILTTIVGILAGIARLSDNWLVRNI 118 G+ + + P Y ++ L GL +L ++ + II+ ++G++ G+AR+S N +R + Sbjct: 107 GDYIYSGDPVGRYEVSKPGILLEGLWITLEVSMLAIIIGIVLGVVTGLARISVNPALRWL 166 Query: 119 SLVYVEIFRNTPLLLQLLFWYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFS 178 ++ Y+EI R +PLL+Q+ WYF V L K+ L L W+ Sbjct: 167 AITYIEIIRGSPLLVQVFLWYFVVGTLLNALFEKVGLSAIPPL--------WYG------ 212 Query: 179 ALLLGLIFYTGAFIAEIVRGGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPL 238 ++ L +TGA++AEIVR GIQSV +GQ EA RSLG++ + MR VI PQA R I+PPL Sbjct: 213 --VMALAIFTGAYVAEIVRAGIQSVHRGQMEAARSLGMSYAQSMRKVILPQAFRRIMPPL 270 Query: 239 TSQYLNLTKNSSLAIAIGYPDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNA 298 Q+++L K+SSL I ++ + + E+ ++ L YL L+ T+SL + Sbjct: 271 AGQFISLVKDSSLLGVIAVRELTKATREVVTTSLQPFELWIVCALLYLVLTFTLSLCVQY 330 Query: 299 FNR 301 R Sbjct: 331 LER 333 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 337 Length adjustment: 28 Effective length of query: 280 Effective length of database: 309 Effective search space: 86520 Effective search space used: 86520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory