Align major cell-binding factor (characterized)
to candidate 207829 DVU2342 amino acid ABC transporter, periplasmic amino acid-binding protein
Query= CharProtDB::CH_021449 (259 letters) >MicrobesOnline__882:207829 Length = 270 Score = 114 bits (284), Expect = 3e-30 Identities = 77/242 (31%), Positives = 128/242 (52%), Gaps = 12/242 (4%) Query: 9 KLAVFALGACVAFSNANAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEIKGFEVDV 68 +L + AL + + A A GKL+ IK +G L+ GVK+ V + +D+ + ++ GF+VD+ Sbjct: 3 RLLLLALTLGLVLTAAVAHAGKLDEIKQRGTLVCGVKDSVVPFGFIDETSKQLVGFDVDI 62 Query: 69 AKLLAKSILGDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQD 128 + +A K+++ V + TR P+L GSVD V AT T ER + +FS Y+ Sbjct: 63 CQFIADRA---GVKLEVKTVTSATRIPMLTQGSVDLVAATMTHKFERDDVIDFSITYFDA 119 Query: 129 AIGLLVLKEKKYKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAA 188 LLV K KS AD+KG + + +T++K + +AA+ + V F E YP A Sbjct: 120 GQRLLVKKGGGIKSAADLKGKKVATVKGSTSEKNM-KAAQPDCVVVSFDE---YPQAFLA 175 Query: 189 LDAKRVDAFSVDKSILLGYVD-----DKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFV 243 L + +A + D+ IL+G + DK +I+ D + YG+ ++D F +V+ + Sbjct: 176 LKQGKAEAVTTDEPILVGLKNSDPEPDKWDIVGDFIASEPYGLGLVENDSKFRDFVNKSL 235 Query: 244 KE 245 E Sbjct: 236 AE 237 Lambda K H 0.316 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 270 Length adjustment: 25 Effective length of query: 234 Effective length of database: 245 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory