Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate 206069 DVU0649 iron compound ABC transporter, permease protein
Query= SwissProt::P15030 (332 letters) >MicrobesOnline__882:206069 Length = 351 Score = 159 bits (403), Expect = 7e-44 Identities = 111/342 (32%), Positives = 172/342 (50%), Gaps = 18/342 (5%) Query: 2 TAIKHPVLLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRL 61 TA+ LW L V A + + + + GA A + GH + +V ++RL Sbjct: 8 TALALGAALWLLSVPAACLFGPFDIGPAEVMRLLGA-AAGVPVSGHVDPIRLLVVGDIRL 66 Query: 62 PRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALA--------MALTSALSP 113 R +++L+G LA+AG + Q + NP+A P LG++SGAAL + L +A++P Sbjct: 67 ARVCLSLLVGGGLAMAGVVFQGVLRNPLADPFTLGVSSGAALGASVAISFGVTLPAAVAP 126 Query: 114 TPIAGYSLSFIAACGGGVSWL----LVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRI 169 +AG + AA G + L L+ TA G FR R ++LAG+ +S F L + Sbjct: 127 ALVAGLGVVTPAALFGAFAALSLVLLLGTAAGSFR----RETVVLAGVVVSTFLAALVSL 182 Query: 170 TLLLAEDHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAH 229 L E+ I +W+ G + W LLP +V + V+ A L++L L D+ A Sbjct: 183 VKALDEESVSSIVFWIMGSLQGRGWAHTAVLLPPLVLGLAAVVRHARDLDVLALGDTQAS 242 Query: 230 TLGVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLL 289 LG+ +R V+ + CV+V+G + F+GL+VPHL R G +L + Sbjct: 243 QLGMRTGYVRCVLLCGASCITAGCVAVSGVIGFVGLVVPHLLRLVLGAAHGPLLIGAWFG 302 Query: 290 GATLMLLADVLARALAFPG-DLPAGAVLALIGSPCFVWLVRR 330 G L+L +DV+AR L G +LP G V AL+G P F L++R Sbjct: 303 GGILLLWSDVVARTLLSGGAELPVGVVTALVGGPFFCLLLQR 344 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 351 Length adjustment: 29 Effective length of query: 303 Effective length of database: 322 Effective search space: 97566 Effective search space used: 97566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory