Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate 206069 DVU0649 iron compound ABC transporter, permease protein
Query= CharProtDB::CH_004160 (318 letters) >MicrobesOnline__882:206069 Length = 351 Score = 174 bits (441), Expect = 3e-48 Identities = 108/285 (37%), Positives = 163/285 (57%), Gaps = 14/285 (4%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPS 105 V+ + RL R+ L+L VG LA+AGV+ QG++RNPLA P LGV+ A+L + A+ + Sbjct: 60 VVGDIRLARVCLSLLVGGGLAMAGVVFQGVLRNPLADPFTLGVSSGAALGASVAISFGVT 119 Query: 106 LPVMVLPLL----------AFAGGMAGLILLKML---AKTHQPMKLALTGVALSACWASL 152 LP V P L A G A L L+ +L A + + + L GV +S A+L Sbjct: 120 LPAAVAPALVAGLGVVTPAALFGAFAALSLVLLLGTAAGSFRRETVVLAGVVVSTFLAAL 179 Query: 153 TDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDA 212 + + V++ + W+ GSL GR W+ + +P ++L L + RDLD+LALGD Sbjct: 180 VSLVKALDEESVSSIVFWIMGSLQGRGWAHTAVLLPPLVLGLAAVVRHARDLDVLALGDT 239 Query: 213 RATTLGVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVS 272 +A+ LG+ + R L A +T+ VA G I F+GLVVPH++R + G H LL + Sbjct: 240 QASQLGMRTGYVRCVLLCGASCITAGCVAVSGVIGFVGLVVPHLLRLVLGAAHGPLLIGA 299 Query: 273 ALTGALLLVVADLLAR-IIHPPLELPVGVLTAIIGAPWFVWLLVR 316 G +LL+ +D++AR ++ ELPVGV+TA++G P+F LL R Sbjct: 300 WFGGGILLLWSDVVARTLLSGGAELPVGVVTALVGGPFFCLLLQR 344 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 351 Length adjustment: 28 Effective length of query: 290 Effective length of database: 323 Effective search space: 93670 Effective search space used: 93670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory