Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate 207406 DVU1936 phosphonate ABC transporter, ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >MicrobesOnline__882:207406 Length = 265 Score = 115 bits (287), Expect = 1e-30 Identities = 75/230 (32%), Positives = 118/230 (51%), Gaps = 9/230 (3%) Query: 2 TLRTENLTVSYGTDK-VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 +L E+L Y K VL D+S ++ TA+IGP+G GKSTLL C +RL+ P +G + Sbjct: 17 SLVVEHLRKEYVRGKAVLKDISFTVSGQSTTAIIGPSGTGKSTLLRCINRLIEPTAGRIL 76 Query: 61 LGDNPINMLSS---RQLARRLSLLPQHHLTPEGITVQELVSYGR----NPWLSLWGRLSA 113 + + L R+ RR+ ++ Q + E ++V E V GR +PW + + Sbjct: 77 VSGEDVCALKGTALREARRRIGMVFQEYNLVERLSVMENVLCGRLGYISPWRAWLRKFPQ 136 Query: 114 EDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINH 173 ED R ++ + A R ELSGGQRQR +A + Q ++L DEPT+ LD Sbjct: 137 EDIDRAFDLLDMVGLADFARARADELSGGQRQRVGIARAVMQEPHILLADEPTSSLDPKT 196 Query: 174 QVDLMRLMGELRTQGKTVVAV-LHDLNQASRYCDQLVVMANGHVMAQGTP 222 V++M L+ + + V V +HD+ R+ D+++ M G V+ P Sbjct: 197 SVEIMELLRAVAEKRDIPVLVNIHDVTLGRRFSDRVIGMCKGEVLFDDVP 246 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 265 Length adjustment: 24 Effective length of query: 231 Effective length of database: 241 Effective search space: 55671 Effective search space used: 55671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory