Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate 208688 DVU3168 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::P04182 (439 letters) >MicrobesOnline__882:208688 Length = 423 Score = 125 bits (313), Expect = 3e-33 Identities = 109/342 (31%), Positives = 161/342 (47%), Gaps = 26/342 (7%) Query: 59 PVALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKIIEAMKSQVDKLTLTSRAFYNN 118 P+ + R G + V+G + DF+ ++G + GH HP++ A+ + VD+ T + Sbjct: 34 PLFIARAAGSRLHTVDGETFIDFVESWGPMLLGHTHPEVTAAVHAAVDRGTSYGAPCEDE 93 Query: 119 VLGEYEEYITKLFNYNKVLPMNTGVEAGETACKLARRWGYTVKGIQKYKAKIVFAVGNFW 178 V+ + + L + V +N+G EA +A +LAR GYT + K+V VG + Sbjct: 94 VVLA-AKVVDALPGVDMVRMVNSGTEATMSALRLAR--GYTGR------TKLVKFVGCYH 144 Query: 179 GRT---LSAVSSSTDPTSYDGFGPFMPGFET-----IPYNDLPALER--ALQDPNVAAFM 228 G L++ S S G P +P PYNDL A++ AL ++AA + Sbjct: 145 GHADPFLASAGSGVATLSIPGT-PGVPESTVRDTLLAPYNDLAAVKDLFALHGKDIAAII 203 Query: 229 VEPIQGEAGVIVPDPGYLTGVRELCTRHQVLFIADEIQTGLARTGRWLAVDHENVRPDIV 288 VE + G G++ P G+L G+RELC +H L I DE+ TG R A + PD+ Sbjct: 204 VEAVAGNMGLVPPKAGFLEGLRELCDQHGALLIFDEVITGF-RVSFGGAQQRFGITPDLT 262 Query: 289 LLGKALSGGLYPVSAVLCDDDIMLTIKP-GE--HGSTYGGNPLGCRIAIAALEVLEEEHL 345 LGK + GGL PV A +IM I P GE T GNPL IA L+VL Sbjct: 263 TLGKIIGGGL-PVGAYGGKREIMQRIAPCGEVYQAGTLSGNPLAMAAGIATLDVLSRSDY 321 Query: 346 AENADKMGAILRKELMKLPSDVVTAVRGKGLLNAIVIRETKD 387 A ++ A + KEL + VR L + + T D Sbjct: 322 AGLEARVAAFV-KELEAILKGKGVPVRINTLASMFTVFFTND 362 Lambda K H 0.319 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 423 Length adjustment: 32 Effective length of query: 407 Effective length of database: 391 Effective search space: 159137 Effective search space used: 159137 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory