GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Desulfovibrio vulgaris Hildenborough

Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate 208544 DVU3030 acetate kinase

Query= BRENDA::Q9WYB1
         (403 letters)



>lcl|MicrobesOnline__882:208544 DVU3030 acetate kinase
          Length = 402

 Score =  433 bits (1114), Expect = e-126
 Identities = 222/404 (54%), Positives = 285/404 (70%), Gaps = 8/404 (1%)

Query: 1   MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRV-----GDEKHVIERE 55
           M VLVINSGSSSIKYQLI+ME E  LC G+ ERIG    +L H++     G+EK   E+ 
Sbjct: 1   MNVLVINSGSSSIKYQLIDMEREVPLCSGLVERIGEPMGKLTHKIRPDAEGEEKLTFEQP 60

Query: 56  LPDHEEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEV 115
             +H E +K ++  + D   GVIKD  EI A+GHRV+ GGE  K+SV +D+     I + 
Sbjct: 61  FTNHVEGMKRVVELITDADKGVIKDKSEIGAIGHRVLLGGEEIKQSVRIDDWAKGVIRDY 120

Query: 116 SPLAPLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRR 175
            PL PLHNPANL GI+ A +L PG+PNV VFDT FHQ++P KAYLY +P E YE+ KIRR
Sbjct: 121 IPLGPLHNPANLAGIEVAEELFPGLPNVGVFDTEFHQSMPAKAYLYPLPIELYEELKIRR 180

Query: 176 YGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGL 235
           YGFHGTSHRY++KR A+ LGK L+EL IITCH+GNG S+AAVK GKCVDT+MG TPLEGL
Sbjct: 181 YGFHGTSHRYITKRTAQYLGKPLDELNIITCHLGNGCSMAAVKNGKCVDTTMGITPLEGL 240

Query: 236 VMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGD 295
           +MGTR GD+DPAI  F+MEK+ +SP E   ++NK+SG+ G+     +DMRD+  A   G+
Sbjct: 241 MMGTRCGDIDPAIVPFLMEKKNLSPAEADTLMNKQSGLKGMCG--MNDMRDLHAARENGN 298

Query: 296 EWCKLVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLD 355
           E  +L  E++ YRI KYIGAY A +  VDA+VFTAG+GEN    R +VC+ L+ LG+ +D
Sbjct: 299 ERAQLAFEMFTYRIKKYIGAYYAVLGRVDAVVFTAGIGENDDFVRAEVCAGLDSLGIAVD 358

Query: 356 KQKNEETIRGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIVE 399
             +N     G+   IS   SRV VLVVPTNEEL IA+ T ++++
Sbjct: 359 PARN-AVRNGQPRHISPDGSRVAVLVVPTNEELEIAQATLDVLK 401


Lambda     K      H
   0.318    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 484
Number of extensions: 23
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 403
Length of database: 402
Length adjustment: 31
Effective length of query: 372
Effective length of database: 371
Effective search space:   138012
Effective search space used:   138012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate 208544 DVU3030 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00016.hmm
# target sequence database:        /tmp/gapView.21962.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00016  [M=405]
Accession:   TIGR00016
Description: ackA: acetate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
   7.1e-150  485.1   0.0   7.9e-150  485.0   0.0    1.0  1  lcl|MicrobesOnline__882:208544  DVU3030 acetate kinase


Domain annotation for each sequence (and alignments):
>> lcl|MicrobesOnline__882:208544  DVU3030 acetate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  485.0   0.0  7.9e-150  7.9e-150       5     402 ..       2     398 ..       1     401 [. 0.95

  Alignments for each domain:
  == domain 1  score: 485.0 bits;  conditional E-value: 7.9e-150
                       TIGR00016   5 kilvlnaGssslkfalldaensekvllsglverikleeariktv....edgekkeeeklaiedheeavkkllntlkk.d 78 
                                      +lv+n+Gsss+k++l+d+e  e  l+sglveri  +  +++ +     +ge+k ++++ +++h e++k++++ +++ d
  lcl|MicrobesOnline__882:208544   2 NVLVINSGSSSIKYQLIDME-REVPLCSGLVERIGEPMGKLTHKirpdAEGEEKLTFEQPFTNHVEGMKRVVELITDaD 79 
                                     79******************.5888*********98765544432343678888999999****************999 PP

                       TIGR00016  79 kkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFDtafH 157
                                     k ++k++sei +iGHRv  Gge+ ++sv ++d +   i+d ++l PlHnpa+l gie + +l+  +  +nv vFDt fH
  lcl|MicrobesOnline__882:208544  80 KGVIKDKSEIGAIGHRVLLGGEEIKQSVRIDDWAKGVIRDYIPLGPLHNPANLAGIEVAEELF--PGLPNVGVFDTEFH 156
                                     ************************************************************555..5567********** PP

                       TIGR00016 158 qtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksidtsmGlt 236
                                     q +p +aylY+lP +ly+el++RrYGfHGtsh+y+t+r+a++l+kpld+ln+i+cHlGnG s++avknGk++dt+mG+t
  lcl|MicrobesOnline__882:208544 157 QSMPAKAYLYPLPIELYEELKIRRYGFHGTSHRYITKRTAQYLGKPLDELNIITCHLGNGCSMAAVKNGKCVDTTMGIT 235
                                     ******************************************************************************* PP

                       TIGR00016 237 PLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklAlkvyvhRia 315
                                     PLeGl+mGtR+GdiDpai+ +l+e+++ls +e  +++nk+sGl g+ g  +D+Rd+ ++ e+gne+a+lA++++++Ri+
  lcl|MicrobesOnline__882:208544 236 PLEGLMMGTRCGDIDPAIVPFLMEKKNLSPAEADTLMNKQSGLKGMCG-MNDMRDLHAARENGNERAQLAFEMFTYRIK 313
                                     ************************************************.89**************************** PP

                       TIGR00016 316 kyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteeskvkvlviptneel 394
                                     kyig+y a l g++Da+vFt+GiGen+  vr++v+ +l++lG+++d+++n   r+g+ + is + s+v vlv+ptneel
  lcl|MicrobesOnline__882:208544 314 KYIGAYYAVL-GRVDAVVFTAGIGENDDFVRAEVCAGLDSLGIAVDPARNA-VRNGQPRHISPDGSRVAVLVVPTNEEL 390
                                     **********.67*************************************9.999************************ PP

                       TIGR00016 395 viaeDalr 402
                                      ia+ +l 
  lcl|MicrobesOnline__882:208544 391 EIAQATLD 398
                                     ***98776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (405 nodes)
Target sequences:                          1  (402 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 6.99
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory