Align RnsD, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized)
to candidate 206503 DVU1069 branched chain amino acid ABC transporter, permease protein
Query= TCDB::Q8DU39 (318 letters) >MicrobesOnline__882:206503 Length = 306 Score = 162 bits (410), Expect = 1e-44 Identities = 106/319 (33%), Positives = 168/319 (52%), Gaps = 24/319 (7%) Query: 1 MSLENMLALLISSMLVYATPLIFTSIGGVFSERSGVVNVGLEGIMVMGAFAGVVFNIEFA 60 M++E ++ +L +++ TP+++ ++G + +ER+GV+N+G+EG+M++G F + Sbjct: 1 MTIEMVIPVLAAAVQC-GTPILYATLGEMLTERAGVLNLGVEGMMIIGTFTAFLA----L 55 Query: 61 HSFGKATPWIAALVGGLVGLLFSLLHALATINFRADHIVSGTVLNLLAPSLAVFFVKALY 120 H G PWIA +V L G L+H + + F+ + +VSG L + LA + Sbjct: 56 HLTGD--PWIAVVVAALCGGALGLVHGIVCLVFQGNQVVSGLALTIFGVGLADYLGTPFV 113 Query: 121 NKGQTDNISQSFGKFDFPILSHIPFLGPIFFQGTSLVAYLAVLFSVFAWFILTKTKFGLR 180 ++ F F P+L IP LG +FF+ +LV VL +F W L +T++GL Sbjct: 114 G-----TVTTGFTPFSLPVLGDIPVLGEVFFRHDALVNLSYVLPPLF-WLFLARTRWGLA 167 Query: 181 LRSVGEHPQAADTLGINVYLMRYLGVMISGLLGGIGGAIYAQSISVNFAGTTILGPGFIA 240 LR+ GEHP AA GIN L+R+ + G L GIGGA + + + + G G+IA Sbjct: 168 LRATGEHPAAAAAAGINPVLVRWAALFAGGALVGIGGAYLSLAYTHLWTNNMTAGRGWIA 227 Query: 241 LAAMIFGKWNPIGAMLSSLFFGLSQSLAVIGGQLPFL---SKIPTVYLQIAPYALTILVL 297 +A +IF W P A+L + FG V+ QL + +P+ L + PYALTI VL Sbjct: 228 VALVIFAFWRPGRAVLGAYLFG-----GVMAFQLRLQAMGASVPSSLLLMLPYALTIGVL 282 Query: 298 AVFFGQAV---APKADGIN 313 + AP A G+N Sbjct: 283 LFSSARGKGRGAPAALGVN 301 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 306 Length adjustment: 27 Effective length of query: 291 Effective length of database: 279 Effective search space: 81189 Effective search space used: 81189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory