Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate 206897 DVU1453 long-chain-fatty-acid--CoA ligase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >MicrobesOnline__882:206897 Length = 564 Score = 224 bits (571), Expect = 7e-63 Identities = 161/562 (28%), Positives = 272/562 (48%), Gaps = 55/562 (9%) Query: 33 AFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNA 92 AF + R P++ A++ + + +YA+L+ A R A+ L G+ PGDRV + N Sbjct: 24 AFLDEAAERHPKQTAII--FRNYKVSYAKLRLLAERFAANLRAQGVLPGDRVSVMLPNVP 81 Query: 93 EWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSM----------------A 136 + ++ + G +V NP Y E+ + ++ G + ++++ Sbjct: 82 QAIIAFWGLLKAGCTVVMTNPLYMEKELVHQIHDSGAEYMIALDLVWPKIEPLRDRLGIR 141 Query: 137 RF---KTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEPGLLRFT 193 +F + SD LG L ++ ++ G + + W L + Sbjct: 142 KFFITRISDALGFPLNLLYRFKAKREGTWRDVPFDGETVIPW-----------KTLFKKK 190 Query: 194 ELIARGNAADPRLAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNN----GFFIG 249 E G +A + A L +Q+T GTTG KG LTH N+ N +G Sbjct: 191 E----GYSAKVENPREALAL-------LQYTGGTTGISKGVMLTHYNLSVNVQQIKAILG 239 Query: 250 ECMKLTPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTG 309 E ++ +P +H +G+ GATI+ P + P VL + + T Sbjct: 240 ESTRMRHT--FLGLMPYFHVYGLTTCLTLPTALGATII-PFPRYVPRDVLVGIDKHKPTI 296 Query: 310 LHGVPTMFIAELDHPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTE 369 G P+++I+ + EF+L +++ I +P P E ++R E + I +G+TE Sbjct: 297 FPGAPSIYISLMQQKDVGEFDLKSIKYCISGSAPMPLEHIRRFHELTGAQVIE-GFGLTE 355 Query: 370 TSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAV-VPIGQRGEFCTKGYSVMHG 428 SPV+ + ++ ++G P E ++VD + G V +P G+ GE +G VM G Sbjct: 356 ASPVTHLNPIHGV--QKPGSIGVPFPDTEARVVDMEVGLVPLPPGKIGELIIRGPQVMQG 413 Query: 429 YWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYR 488 Y +T + GW++TGD+ATMD +GY IV R KDM+I GG N+YPREI+E L+ Sbjct: 414 YLNRPDETANTL-RNGWLYTGDIATMDEDGYFFIVDRKKDMIIVGGYNVYPREIDEVLHE 472 Query: 489 HPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTS 548 HP+V++ VGVP GE + A+I+ + G + T+ +I A C+ Q+A+YKVP+ + F Sbjct: 473 HPKVKEAVTVGVPHATRGEIIKAYIVPREGVKLTKAEIVAHCREQLANYKVPKQVEFRNE 532 Query: 549 FPMTVTGKIQKFKIRDEMKDQL 570 P T+ GK+ + +R E +++L Sbjct: 533 LPKTIVGKVLRRILRAEEEERL 554 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 797 Number of extensions: 52 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 564 Length adjustment: 36 Effective length of query: 542 Effective length of database: 528 Effective search space: 286176 Effective search space used: 286176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory