Align L-fuculose phosphate aldolase; EC 4.1.2.17; L-fuculose-1-phosphate aldolase (uncharacterized)
to candidate 209090 DVU0158 conserved hypothetical protein TIGR00104
Query= curated2:Q8FEF0 (215 letters) >MicrobesOnline__882:209090 Length = 332 Score = 78.6 bits (192), Expect = 1e-19 Identities = 55/175 (31%), Positives = 84/175 (48%), Gaps = 3/175 (1%) Query: 14 CLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFID-GNGKHEEGKLPSS 72 C + GL G GNVS+R L+T TG L+ + +D +GK G PSS Sbjct: 158 CHTAWQRGLLSGFNGNVSLRLGATCLVTCTGAAKGDLSPGDLAVVDIASGKRIAGGKPSS 217 Query: 73 EWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAG--GNSIPCAPYAT 130 E H+ Y+ +P A A+VH H A+ + P +H + A + + AP Sbjct: 218 ELAMHLEVYRRQPRAQAIVHTHPPRLLALGLRVAPQQMLHIDVYEAQMLVSRLGSAPAHA 277 Query: 131 FGTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVLAQLYLTTL 185 GT+ L++ V A R+A ++ HGL+ +AL L E+E LA ++L+ L Sbjct: 278 PGTQALADAVGEAAVTREAVWMERHGLVCWGETPMQALALGEELEHLAGIHLSVL 332 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 332 Length adjustment: 25 Effective length of query: 190 Effective length of database: 307 Effective search space: 58330 Effective search space used: 58330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory